Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1447
Gene name
LocationContig_1319:3065..4851
Strand-
Gene length (bp)1786
Transcript length (bp)1611
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.2E-30 81 444
PF00083 Sugar_tr Sugar (and other) transporter 1.0E-11 82 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 67 535 8.0E-49
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 116 529 4.0E-41
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 83 526 2.0E-35
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 123 526 1.0E-32
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 123 526 1.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 67 535 8.0E-49
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 116 529 4.0E-41
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 83 526 2.0E-35
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 123 526 1.0E-32
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 123 526 1.0E-32
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 116 536 2.0E-27
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 111 521 4.0E-27
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 22 536 4.0E-25
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 122 534 9.0E-25
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 57 536 4.0E-23
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 67 516 5.0E-23
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 114 498 2.0E-21
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 70 520 1.0E-18
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 105 447 9.0E-18
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 60 473 3.0E-16
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 116 454 5.0E-16
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 116 403 1.0E-15
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 116 403 1.0E-15
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 112 460 3.0E-15
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 132 520 3.0E-15
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 110 513 1.0E-13
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 110 513 1.0E-13
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 115 453 5.0E-13
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 112 383 9.0E-13
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 57 451 4.0E-12
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 106 460 1.0E-11
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 114 362 2.0E-11
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 118 490 1.0E-10
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 116 372 7.0E-10
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 116 466 1.0E-09
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 115 460 2.0E-09
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 114 457 2.0E-09
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 115 460 2.0E-09
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 112 363 2.0E-09
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 112 363 3.0E-09
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 114 457 4.0E-09
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 110 205 1.0E-08
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 112 382 4.0E-08
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 118 454 1.0E-07
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 110 490 1.0E-07
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 114 455 2.0E-07
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 114 443 2.0E-07
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 114 455 3.0E-07
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 114 455 3.0E-07
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 114 455 3.0E-07
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 114 455 3.0E-07
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 114 455 3.0E-07
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 114 455 3.0E-07
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 114 455 3.0E-07
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 114 455 3.0E-07
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 114 443 3.0E-07
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 110 459 4.0E-07
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 116 363 5.0E-07
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 116 363 5.0E-07
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 116 363 5.0E-07
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 116 363 5.0E-07
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 116 363 5.0E-07
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 116 363 5.0E-07
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 116 363 5.0E-07
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 116 363 5.0E-07
sp|P14551|TCR_STRRM Tetracycline resistance determinant OS=Streptomyces rimosus GN=tetB PE=3 SV=1 286 508 6.0E-07
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 112 448 7.0E-07
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 114 466 7.0E-07
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 115 459 7.0E-07
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 115 459 7.0E-07
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 108 375 7.0E-07
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 114 444 9.0E-07
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 114 455 2.0E-06
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 111 343 2.0E-06
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 111 343 2.0E-06
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 112 448 2.0E-06
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 116 473 3.0E-06
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 116 473 3.0E-06
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 113 382 4.0E-06
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 113 382 4.0E-06
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 107 472 5.0E-06
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 112 466 5.0E-06
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 113 262 6.0E-06
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 113 382 6.0E-06
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 116 363 7.0E-06
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 113 382 7.0E-06
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 113 382 7.0E-06
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 113 382 7.0E-06
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 113 382 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 77 96 19
2 101 123 22
3 132 154 22
4 194 216 22
5 229 251 22
6 261 283 22
7 304 326 22
8 341 358 17
9 365 384 19
10 399 421 22
11 434 456 22
12 502 524 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1447
MRGSGDESRASGLGQDERAPLLRPEAESEALPGHGEPQPESGASRPARQNPGGHGGDDDDDDDDDDERTVIAKEL
PLARLAFIMGTAWFGVFLGAIDSTIIATLSASIAIFSNIFFAMGNLICGLARDDGAMIAGRVIAGIGGGGLMSIS
TFLGSDLIPLRNRGLAQGLGNLCYGSGAMLGGIFGGLMNDHTQWGWRLAFLVQVPPVLVSAVAVAILVKVPPKQS
DRSYIARIDFVGVLLTSSFLVLLLLGLNSGGNQVPWTHPLPLVSIPLSVITFGMFLWWESKARQPIIPVTLLLRR
TVLAACLCNLLSTMVIMAGLFYVPLYLQVLGDSATQAGLKILPSPLGAAVFSVGSGYIMKRTGRYTRLGVSSLVV
LIVGIVLFTLQGRDSPFWLSSVAFFFVGGGYSAMLTTTLLACVAAVDHSQQAVVTSSTYLARSVGSTMGVTVGSA
VYQNILKARLWDRFGDFPGAAEEIRRIRDDLSELKHLPDGWYEGVMDSFMEAFRGVWLTMLAMAVGALICVSMMR
HHTLHATLERR*
Coding >Hirsu2|1447
ATGAGGGGGAGCGGAGACGAGAGCCGGGCCTCGGGCCTTGGGCAAGATGAGCGGGCCCCGCTGCTGCGGCCCGAA
GCCGAGTCTGAAGCTCTGCCGGGCCACGGTGAGCCTCAGCCCGAGAGCGGGGCGAGCCGGCCGGCGCGGCAGAAC
CCGGGGGGGCATGGCGGAGACGACGACGACGACGACGACGACGACGACGAGAGAACCGTGATAGCCAAGGAACTG
CCCCTGGCGAGGCTGGCCTTTATCATGGGCACGGCCTGGTTCGGCGTCTTCCTAGGCGCCATCGACTCGACTATC
ATCGCGACGCTGTCGGCCTCGATCGCGATCTTTAGCAATATCTTCTTCGCTATGGGCAATCTGATCTGCGGTCTG
GCGCGCGACGACGGCGCCATGATCGCGGGTCGCGTTATCGCCGGGATCGGCGGCGGTGGTCTTATGAGTATCTCT
ACCTTCCTGGGCTCCGACCTGATCCCGCTGCGGAACAGAGGACTGGCCCAGGGTCTCGGCAACCTCTGCTACGGC
TCGGGAGCCATGCTAGGCGGTATCTTCGGAGGTCTGATGAACGACCATACGCAGTGGGGCTGGAGGCTGGCCTTT
CTGGTTCAGGTTCCCCCCGTGCTGGTCTCGGCTGTCGCCGTCGCCATCCTCGTCAAGGTGCCGCCAAAGCAATCG
GATAGATCCTACATCGCCCGCATCGACTTCGTCGGCGTTCTCCTGACGTCGTCCTTCCTCGTCCTGCTTCTTCTA
GGCCTAAACTCGGGCGGGAATCAGGTTCCTTGGACACACCCGCTGCCTCTCGTGTCCATTCCGCTGTCAGTCATC
ACCTTCGGCATGTTCCTCTGGTGGGAGAGCAAAGCTCGCCAGCCCATCATCCCGGTCACGCTCCTCTTGCGGCGT
ACCGTTTTGGCGGCCTGTCTTTGCAACCTGCTCAGTACCATGGTCATCATGGCTGGCCTCTTCTACGTACCGCTG
TACCTGCAGGTCTTGGGCGACTCGGCGACACAGGCTGGACTCAAGATTCTGCCGTCCCCTCTTGGCGCCGCCGTC
TTCTCGGTAGGGTCGGGGTATATCATGAAGCGGACCGGGCGTTACACCCGGCTCGGCGTCTCCAGCCTCGTCGTC
TTGATTGTCGGCATCGTTCTCTTCACCCTGCAGGGGAGAGACAGTCCGTTCTGGCTGAGCAGCGTGGCCTTCTTC
TTTGTCGGAGGCGGATACAGTGCCATGTTGACCACGACGTTGCTGGCCTGCGTCGCGGCAGTCGATCATTCGCAG
CAGGCCGTCGTCACGTCGTCAACTTACTTGGCGAGAAGCGTCGGCAGCACCATGGGAGTGACGGTTGGATCGGCC
GTGTATCAAAACATACTCAAGGCTCGTCTTTGGGACCGGTTCGGCGATTTTCCGGGCGCGGCCGAGGAAATCAGG
CGGATCCGCGACGACCTGAGCGAGCTGAAGCATCTTCCCGACGGCTGGTACGAAGGCGTTATGGACTCGTTTATG
GAGGCGTTTCGGGGCGTGTGGCTGACGATGCTCGCCATGGCCGTTGGGGCTTTGATCTGTGTATCCATGATGCGG
CATCACACGCTGCATGCTACGTTGGAGCGGCGATAG
Transcript >Hirsu2|1447
ATGAGGGGGAGCGGAGACGAGAGCCGGGCCTCGGGCCTTGGGCAAGATGAGCGGGCCCCGCTGCTGCGGCCCGAA
GCCGAGTCTGAAGCTCTGCCGGGCCACGGTGAGCCTCAGCCCGAGAGCGGGGCGAGCCGGCCGGCGCGGCAGAAC
CCGGGGGGGCATGGCGGAGACGACGACGACGACGACGACGACGACGACGAGAGAACCGTGATAGCCAAGGAACTG
CCCCTGGCGAGGCTGGCCTTTATCATGGGCACGGCCTGGTTCGGCGTCTTCCTAGGCGCCATCGACTCGACTATC
ATCGCGACGCTGTCGGCCTCGATCGCGATCTTTAGCAATATCTTCTTCGCTATGGGCAATCTGATCTGCGGTCTG
GCGCGCGACGACGGCGCCATGATCGCGGGTCGCGTTATCGCCGGGATCGGCGGCGGTGGTCTTATGAGTATCTCT
ACCTTCCTGGGCTCCGACCTGATCCCGCTGCGGAACAGAGGACTGGCCCAGGGTCTCGGCAACCTCTGCTACGGC
TCGGGAGCCATGCTAGGCGGTATCTTCGGAGGTCTGATGAACGACCATACGCAGTGGGGCTGGAGGCTGGCCTTT
CTGGTTCAGGTTCCCCCCGTGCTGGTCTCGGCTGTCGCCGTCGCCATCCTCGTCAAGGTGCCGCCAAAGCAATCG
GATAGATCCTACATCGCCCGCATCGACTTCGTCGGCGTTCTCCTGACGTCGTCCTTCCTCGTCCTGCTTCTTCTA
GGCCTAAACTCGGGCGGGAATCAGGTTCCTTGGACACACCCGCTGCCTCTCGTGTCCATTCCGCTGTCAGTCATC
ACCTTCGGCATGTTCCTCTGGTGGGAGAGCAAAGCTCGCCAGCCCATCATCCCGGTCACGCTCCTCTTGCGGCGT
ACCGTTTTGGCGGCCTGTCTTTGCAACCTGCTCAGTACCATGGTCATCATGGCTGGCCTCTTCTACGTACCGCTG
TACCTGCAGGTCTTGGGCGACTCGGCGACACAGGCTGGACTCAAGATTCTGCCGTCCCCTCTTGGCGCCGCCGTC
TTCTCGGTAGGGTCGGGGTATATCATGAAGCGGACCGGGCGTTACACCCGGCTCGGCGTCTCCAGCCTCGTCGTC
TTGATTGTCGGCATCGTTCTCTTCACCCTGCAGGGGAGAGACAGTCCGTTCTGGCTGAGCAGCGTGGCCTTCTTC
TTTGTCGGAGGCGGATACAGTGCCATGTTGACCACGACGTTGCTGGCCTGCGTCGCGGCAGTCGATCATTCGCAG
CAGGCCGTCGTCACGTCGTCAACTTACTTGGCGAGAAGCGTCGGCAGCACCATGGGAGTGACGGTTGGATCGGCC
GTGTATCAAAACATACTCAAGGCTCGTCTTTGGGACCGGTTCGGCGATTTTCCGGGCGCGGCCGAGGAAATCAGG
CGGATCCGCGACGACCTGAGCGAGCTGAAGCATCTTCCCGACGGCTGGTACGAAGGCGTTATGGACTCGTTTATG
GAGGCGTTTCGGGGCGTGTGGCTGACGATGCTCGCCATGGCCGTTGGGGCTTTGATCTGTGTATCCATGATGCGG
CATCACACGCTGCATGCTACGTTGGAGCGGCGATAG
Gene >Hirsu2|1447
ATGAGGGGGAGCGGAGACGAGAGCCGGGCCTCGGGCCTTGGGCAAGATGAGCGGGCCCCGCTGCTGCGGCCCGAA
GCCGAGTCTGAAGCTCTGCCGGGCCACGGTGAGCCTCAGCCCGAGAGCGGGGCGAGCCGGCCGGCGCGGCAGAAC
CCGGGGGGGCATGGCGGAGACGACGACGACGACGACGACGACGACGACGAGAGAACCGTGATAGCCAAGGAACTG
CCCCTGGCGAGGCTGGCCTTTATCATGGGCACGGCCTGGTTCGGCGTCTTCCTAGGCGCCATCGACTCGACTATC
ATCGCGACGCTGTCGGCCTCGATCGCGAGTGAGTTTCGCTCGCTGAGCTTACTGTCTTGGCTGGCCACCGCCTAT
CTTATAGCCAACGCGGCTTTTCAGCCTATTTCGGGCCGGCTTACCGATATCTTCGGTCGCGGGCCCGGCCTAGTC
TTTAGCAATATCTTCTTCGCTATGGGCAATCTGATCTGCGGTCTGGCGCGCGACGACGGCGCCATGATCGCGGGT
CGCGTTATCGCCGGGATCGGCGGCGGTGGTCTTATGAGTATCTCTACCTTCCTGGGCTCCGACCTGATCCCGCTG
CGGAACAGAGGACTGGCCCAGGGTCTCGGCAACCTCTGCTACGGCTCGGGAGCCATGCTAGGCGGTATCTTCGGA
GGTCTGATGAACGACCATACGCAGTGGGGCTGGAGGCTGGCCTTTCTGGTTCAGGTTCCCCCCGTGCTGGTCTCG
GCTGTCGCCGTCGCCATCCTCGTCAAGGTGCCGCCAAAGCAATCGGATAGATCCTACATCGCCCGCATCGACTTC
GTCGGCGTTCTCCTGACGTCGTCCTTCCTCGTCCTGCTTCTTCTAGGCCTAAACTCGGGCGGGAATCAGGTTCCT
TGGACACACCCGCTGCCTCTCGTGTCCATTCCGCTGTCAGTCATCACCTTCGGCATGTTCCTCTGGTGGGAGAGC
AAAGCTCGCCAGCCCATCATCCCGGTCACGCTCCTCTTGCGGCGTACCGTTTTGGCGGCCTGTCTTTGCAACCTG
CTCAGTACCATGGTCATCATGGCTGGCCTCTTCTACGTACCGCTGTACCTGCAGGTCTTGGGCGACTCGGCGACA
CAGGCTGGACTCAAGATTCTGCCGTCCCCTCTTGGCGCCGCCGTCTTCTCGGTAGGGTCGGGGTATATCATGAAG
CGGACCGGGCGTTACACCCGGCTCGGCGTCTCCAGCCTCGTCGTCTTGATTGTCGGCATCGTTCTCTTCACCCTG
CAGGGGAGAGACAGTCCGTTCTGGCTGAGCAGCGTGGCCTTCTTCTTTGTCGGAGGCGGATACAGTGCCATGTTG
ACCACGACGTTGCTGGCCTGCGTCGCGGCAGTCGATCATTCGCAGCAGGCCGTCGTCACGTCGTCAACTTGTAGG
TGGCGCTCCACCAGCTGCCCCGAGGTCGTCCCGACTGACGAATCTTGTAGACTTGGCGAGAAGCGTCGGCAGCAC
CATGGGAGTGACGGTTGGATCGGCCGTGTATCAAAACATACTCAAGGCTCGTCTTTGGGACCGGTTCGGCGATTT
TCCGGGCGCGGCCGAGGAAATCAGGCGGATCCGCGACGACCTGAGCGAGCTGAAGCATCTTCCCGACGGCTGGTA
CGAAGGCGTTATGGACTCGTTTATGGAGGCGTTTCGGGGCGTGTGGCTGACGATGCTCGCCATGGCCGTTGGGGC
TTTGATCTGTGTATCCATGATGCGGCATCACACGCTGCATGCTACGTTGGAGCGGCGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail