Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1439
Gene name
LocationContig_1315:2940..4438
Strand+
Gene length (bp)1498
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 1.8E-32 4 386
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 5.5E-05 6 57

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O43029|FAP1_SCHPO L-pipecolate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap1 PE=1 SV=1 2 404 3.0E-39
sp|Q9UTM9|FAP2_SCHPO L-saccharopine oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap2 PE=1 SV=1 5 424 1.0E-36
sp|B7LT77|MTOX_ESCF3 N-methyl-L-tryptophan oxidase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=solA PE=3 SV=1 5 389 5.0E-09
sp|P40859|MSOX_BACB0 Monomeric sarcosine oxidase OS=Bacillus sp. (strain B-0618) GN=soxA PE=1 SV=2 5 212 1.0E-06

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1439
MTSYLIIGAGNFGAATALTLARRGDARVTLIDTAPFPNPRAASHDVNKIVRDDYPDKLYMRMLIKAMPKWRNDKL
YSTYYHEVGMLRADESNFGQESMAAYRDMGVANDSEFLPVAEVRRRWNGAFATANFDGLDKILFNPTVGYAEADK
ALGAVVQAAVDHGVEYVVGVVRRLNLNAAGQCTGLTLETGETMQADKVLLAAGARTPALLAQSAPEKKELHVGDR
VVATGAISFYAKLFGEQRDKFAPIPVLKNCLPQVKGEGMSILKDGTIKFNCDMCFTNYVTFPPTGERMSVAPDQN
VFNVWTGPRFISFFQERARKTIDGLYGKEVEEIPIDAYRMCWDASTPTHDFLITPHPHCQGLYVATGGSFHGWKF
LPVIGDYVADMMQGSLDAEYTDRWAWDKKGGDGHSANPTYQVVGDLQDWIV*
Coding >Hirsu2|1439
ATGACTTCCTACCTCATCATTGGCGCCGGCAACTTTGGCGCCGCCACCGCCCTGACCCTCGCCAGGCGCGGCGAT
GCCAGGGTGACGCTTATCGACACGGCCCCCTTTCCCAACCCGAGAGCCGCATCGCATGATGTCAACAAGATCGTC
CGCGACGACTACCCCGACAAGCTCTACATGCGCATGCTCATCAAGGCCATGCCCAAATGGCGCAACGACAAGCTG
TACAGCACCTATTACCACGAGGTCGGCATGCTGCGGGCCGACGAATCCAATTTTGGCCAGGAGAGCATGGCCGCC
TACAGAGACATGGGCGTCGCCAACGACTCCGAGTTCTTGCCCGTCGCCGAGGTGCGCCGGCGCTGGAACGGCGCC
TTTGCCACGGCCAACTTCGACGGCCTGGACAAGATCCTCTTCAACCCAACCGTTGGCTACGCCGAGGCCGACAAG
GCACTGGGGGCCGTGGTGCAGGCCGCCGTGGATCACGGCGTCGAGTACGTCGTGGGCGTGGTCAGGAGGCTAAAC
CTGAACGCTGCCGGCCAATGTACGGGCCTCACTTTGGAGACGGGTGAGACAATGCAGGCCGACAAGGTCCTGCTG
GCGGCGGGTGCCCGCACCCCGGCTCTGCTGGCCCAGAGCGCGCCGGAGAAGAAGGAGCTGCACGTTGGTGACCGT
GTGGTGGCCACCGGGGCCATCAGCTTCTACGCGAAGCTCTTTGGGGAACAAAGGGACAAGTTTGCGCCAATTCCG
GTTCTCAAGAACTGCTTGCCGCAGGTCAAAGGCGAGGGCATGTCCATTCTCAAGGACGGCACCATCAAGTTCAAC
TGCGACATGTGCTTCACCAACTACGTCACATTTCCTCCGACCGGTGAACGCATGTCGGTAGCCCCGGACCAAAAC
GTCTTCAACGTGTGGACCGGACCGCGCTTCATCAGCTTCTTCCAGGAACGTGCACGCAAGACTATTGACGGCCTT
TACGGCAAGGAAGTCGAAGAGATTCCCATCGACGCCTATCGAATGTGTTGGGACGCATCGACTCCCACCCACGAC
TTTCTGATCACGCCGCATCCGCACTGCCAAGGCCTCTACGTGGCCACGGGCGGCTCGTTTCACGGATGGAAATTC
TTGCCGGTGATTGGAGACTATGTTGCCGACATGATGCAGGGCAGCCTGGATGCCGAATACACTGACCGTTGGGCT
TGGGACAAGAAGGGCGGTGATGGTCATTCTGCCAATCCGACATACCAAGTTGTCGGGGACCTGCAGGACTGGATC
GTGTGA
Transcript >Hirsu2|1439
ATGACTTCCTACCTCATCATTGGCGCCGGCAACTTTGGCGCCGCCACCGCCCTGACCCTCGCCAGGCGCGGCGAT
GCCAGGGTGACGCTTATCGACACGGCCCCCTTTCCCAACCCGAGAGCCGCATCGCATGATGTCAACAAGATCGTC
CGCGACGACTACCCCGACAAGCTCTACATGCGCATGCTCATCAAGGCCATGCCCAAATGGCGCAACGACAAGCTG
TACAGCACCTATTACCACGAGGTCGGCATGCTGCGGGCCGACGAATCCAATTTTGGCCAGGAGAGCATGGCCGCC
TACAGAGACATGGGCGTCGCCAACGACTCCGAGTTCTTGCCCGTCGCCGAGGTGCGCCGGCGCTGGAACGGCGCC
TTTGCCACGGCCAACTTCGACGGCCTGGACAAGATCCTCTTCAACCCAACCGTTGGCTACGCCGAGGCCGACAAG
GCACTGGGGGCCGTGGTGCAGGCCGCCGTGGATCACGGCGTCGAGTACGTCGTGGGCGTGGTCAGGAGGCTAAAC
CTGAACGCTGCCGGCCAATGTACGGGCCTCACTTTGGAGACGGGTGAGACAATGCAGGCCGACAAGGTCCTGCTG
GCGGCGGGTGCCCGCACCCCGGCTCTGCTGGCCCAGAGCGCGCCGGAGAAGAAGGAGCTGCACGTTGGTGACCGT
GTGGTGGCCACCGGGGCCATCAGCTTCTACGCGAAGCTCTTTGGGGAACAAAGGGACAAGTTTGCGCCAATTCCG
GTTCTCAAGAACTGCTTGCCGCAGGTCAAAGGCGAGGGCATGTCCATTCTCAAGGACGGCACCATCAAGTTCAAC
TGCGACATGTGCTTCACCAACTACGTCACATTTCCTCCGACCGGTGAACGCATGTCGGTAGCCCCGGACCAAAAC
GTCTTCAACGTGTGGACCGGACCGCGCTTCATCAGCTTCTTCCAGGAACGTGCACGCAAGACTATTGACGGCCTT
TACGGCAAGGAAGTCGAAGAGATTCCCATCGACGCCTATCGAATGTGTTGGGACGCATCGACTCCCACCCACGAC
TTTCTGATCACGCCGCATCCGCACTGCCAAGGCCTCTACGTGGCCACGGGCGGCTCGTTTCACGGATGGAAATTC
TTGCCGGTGATTGGAGACTATGTTGCCGACATGATGCAGGGCAGCCTGGATGCCGAATACACTGACCGTTGGGCT
TGGGACAAGAAGGGCGGTGATGGTCATTCTGCCAATCCGACATACCAAGTTGTCGGGGACCTGCAGGACTGGATC
GTGTGA
Gene >Hirsu2|1439
ATGACTTCCTACCTCATCATTGGCGCCGGCAACTTTGGCGCCGCCACCGCCCTGACCCTCGCCAGGCGCGGCGAT
GCCAGGGTGACGCTTATCGACACGGCCCCCTTTCCCAACCCGAGAGCCGCATCGCATGATGTCAACAAGATCGTC
CGCGACGACTACCCCGACAAGCTCTACATGCGCATGCTCATCAAGGCCATGCCCAAATGGCGCAACGACAAGCTG
TACAGCACCTATTACCACGAGGTCGGCATGCTGCGGGCCGACGAATCCAATTTTGGCCAGGAGAGCATGGCCGCC
TACAGAGACATGGGCGTCGCCAACGACTCCGAGTTCTTGCCCGTCGCCGAGGTGCGCCGGCGCTGGAACGGCGCC
TTTGCCACGGCCAACTTCGACGGCCTGGACAAGATCCTCTTCAACCCAACCGTTGGCTACGCCGAGGCCGACAAG
GCACTGGGGGCCGTGGTGCAGGCCGCCGTGGATCACGGCGTCGAGTACGTCGTGGGCGTGGTCAGGAGGCTAAAC
CTGAACGCTGCCGGCCAATGTACGGGCCTCACTTTGGAGACGGGTGAGACAATGCAGGCCGACAAGGTCCTGCTG
GCGGCGGGTGCCCGCACCCCGGCTCTGCTGGCCCAGAGCGCGCCGGAGAAGAAGGAGCTGCACGTTGGTGACCGT
GTGGTGGCCACCGGGGCCATCAGCTTCTACGCGAAGCTCTTTGGGGAACAAAGGGACAAGTTTGCGCCAATTCCG
GTTCTCAAGAACTGCTTGCCGCAGGTCAAAGGTACGTCCCCGCGAGGCCATTGGCGAGGATGAGACTGACCGGTC
TGGCGCGCCGGCCCGCTGCAGGCGAGGGCATGTCCATTCTCAAGGACGGCACCATCAAGTTCAACTGCGACATGT
GCTTCACCAACTACGTCACATTTCCTCCGACCGGTGAACGCATGTCGGTAGCCCCGGACCAAAACGTCTTCAACG
TGTGGACCGGACCGCGCTTCATCAGCTTCTTCCAGGAACGTGCACGCAAGACTATTGACGGCCTTTACGGCAAGG
AAGTCGAAGAGATTCCCATCGACGCCTATCGAATGTGTTGGTAGGTCCTCCTCTCATCGGATCGAACCACATCAA
AGCCCTCCCCCCCCCACCCCCCTCTTTTTTTTTCCCTTTCTCTCGAAGGTCATCAAGACATGCAATCTCGACCAA
TGGGAGAGACGACTTGTTGACGGCTCGGACGTTACCTTTTAGGGACGCATCGACTCCCACCCACGACTTTCTGAT
CACGCCGCATCCGCACTGCCAAGGCCTCTACGTGGCCACGGGCGGCTCGTTTCACGGATGGAAATTCTTGCCGGT
GATTGGAGACTATGTTGCCGACATGATGCAGGGCAGCCTGGATGCCGAATACACTGACCGTTGGGCTTGGGACAA
GAAGGGCGGTGATGGTCATTCTGCCAATCCGACATACCAAGTTGTCGGGGACCTGCAGGACTGGATCGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail