Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1435
Gene name
LocationContig_1313:4069..6505
Strand+
Gene length (bp)2436
Transcript length (bp)2436
Coding sequence length (bp)2436
Protein length (aa) 812

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13515 FUSC_2 Fusaric acid resistance protein-like 5.3E-08 696 790

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53120|YGO0_YEAST Uncharacterized membrane protein YGL140C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL140C PE=1 SV=1 23 554 6.0E-23
sp|P53120|YGO0_YEAST Uncharacterized membrane protein YGL140C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL140C PE=1 SV=1 671 777 1.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 74 96 22
2 106 124 18
3 131 150 19
4 160 179 19
5 674 696 22
6 716 738 22
7 751 770 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1435
MAPPMPRRSLVLMIWGSCEANDLWQRILKYSIACIAAVSIALLPALQDKSVFLIPMVTVFAHPGQRMGLMIEALL
MVLLGSLLGLAWALLGLYLASLVDDSNPAAAYTIRALFFLLCLLVHGYLRSSNPRILIFVLYLVIANLLTIQLPT
DTTSALFTSIYIPVLIGAGILLLVNLAIFRELSSSYLGLSTINSLSETVDTLTRATHWFVTPGGDAVDNRPRPPL
LAPTLTAGGSIPEKQAKKHRIRQFFSQFPNPFHTVKARSALASVPLPSTKLVHLTEQKPRLRAQLGRCQAAQEEV
NFEAFLSPLPPTALKPISIQHMTGIVKNVITLIGACENKFVVVENAAASVGLSGSDKKPDSPVTPESRPGSPKPA
TDGESGAEDRKPRKKKKKRPRLNKVHSVKPVKELEASSAQLLESILARIRGPVQQFQISLTEASNLVIMCLAYCF
DVSTLPSGARAPRGIPLEEIDLRIDQFARSLAVFDSTSAEQLKQATMDQSCQSVDFMPGMETFLVSSFILAFRDS
AEQLLDMLHHARRLIEKRQLRRDRSRLWFPQYASLRRRLAPRAGDAPCSSEVSEKAQRAAADDGDGRNPSRARET
RAAGEFRSRRNADEESSVGQYEDWGGRQEKRLAEGARRARSSPEQPSSLGWVGKARAKAADFLEWAQHSKHLDFA
LKLSIAVFLVLWPAFVTSWHSWYAEVRGIWAPMQLILVFDVAIGTSLFGFAVRLFGVVFGCVFGFLAYEIGRGNR
IAVAAVLAFGLVPSIYIQVATKYAKAGMVSIVSMTVVAIGKSPRPSAVAQGKGSQRSVQRP*
Coding >Hirsu2|1435
ATGGCGCCTCCCATGCCGCGCCGCAGCCTGGTCCTCATGATATGGGGATCCTGCGAGGCTAACGACCTCTGGCAG
CGCATCCTCAAGTATTCCATCGCCTGCATCGCCGCCGTCAGCATCGCCCTGCTCCCCGCCCTGCAGGACAAGTCC
GTCTTCCTCATCCCCATGGTCACCGTCTTCGCCCACCCCGGCCAGCGAATGGGCCTCATGATCGAGGCCTTGCTC
ATGGTCCTCCTCGGCTCTCTTCTCGGCCTGGCCTGGGCCTTGCTGGGCCTCTACCTGGCCAGCCTTGTCGACGAC
TCCAACCCGGCCGCCGCCTACACCATCCGCGCCCTCTTCTTTCTCCTCTGCCTGCTCGTCCATGGCTACCTGAGG
TCGTCGAACCCTCGAATCCTCATCTTTGTCCTCTACCTCGTCATCGCAAATCTCTTGACCATTCAGCTGCCGACC
GACACAACCAGCGCCCTCTTCACTTCAATCTACATCCCTGTCCTCATTGGCGCCGGCATCTTGCTCCTGGTCAAC
CTCGCCATCTTCCGAGAACTCTCCAGCAGCTATCTGGGCCTCTCAACCATCAACTCCCTGTCGGAAACCGTCGAC
ACCCTGACGCGCGCAACCCACTGGTTTGTCACTCCGGGTGGCGATGCTGTCGACAACAGGCCCAGGCCACCTTTG
CTCGCCCCGACTCTGACGGCGGGTGGCAGCATCCCCGAAAAGCAAGCCAAGAAGCATCGAATCAGACAATTCTTC
TCCCAGTTCCCCAACCCCTTCCACACGGTCAAGGCTCGCTCCGCCTTGGCTTCTGTTCCTCTGCCTTCCACCAAG
CTGGTTCATCTGACGGAACAGAAACCTAGGCTTCGCGCCCAGCTTGGCCGCTGTCAGGCGGCTCAGGAAGAAGTC
AACTTCGAGGCTTTCCTCTCGCCTCTGCCCCCGACCGCGCTGAAGCCCATCAGCATCCAACACATGACGGGCATC
GTCAAGAATGTCATCACTTTGATTGGTGCGTGCGAGAACAAGTTTGTCGTGGTGGAAAACGCTGCCGCCAGCGTC
GGCTTGTCGGGATCCGACAAGAAACCAGACTCACCAGTCACTCCGGAATCGAGACCAGGGAGCCCGAAGCCGGCC
ACCGACGGAGAATCGGGCGCTGAGGATCGAAAACCGAGGAAGAAGAAGAAGAAGAGGCCTCGTTTGAACAAGGTA
CACAGCGTCAAACCCGTCAAAGAACTCGAGGCCAGCAGTGCCCAGCTGCTGGAATCGATCCTCGCCCGGATTCGG
GGTCCCGTGCAACAGTTCCAAATCTCCTTGACAGAGGCTTCCAATCTAGTCATAATGTGTCTTGCCTATTGTTTC
GACGTGTCGACGTTACCCTCGGGCGCTCGGGCGCCCAGAGGCATACCGTTGGAGGAGATTGACCTGCGAATCGAC
CAATTCGCTCGTTCGCTCGCCGTTTTTGATTCGACGTCGGCCGAACAGCTCAAGCAGGCCACCATGGACCAGTCT
TGCCAGTCGGTTGACTTCATGCCCGGCATGGAGACCTTTCTGGTATCGTCCTTCATCCTGGCCTTTCGGGACTCT
GCGGAGCAGCTGCTGGACATGTTACACCACGCGCGACGCCTCATCGAGAAGAGGCAACTGCGCCGCGACCGGTCG
CGTCTCTGGTTCCCGCAGTACGCCAGTCTCCGCCGGCGGCTGGCGCCCAGAGCCGGCGATGCGCCATGTTCCTCC
GAAGTGTCCGAGAAGGCGCAGCGCGCGGCCGCGGATGATGGAGACGGGAGAAATCCTTCTCGCGCAAGAGAGACG
CGGGCGGCTGGCGAGTTCCGCTCCCGCCGAAATGCAGATGAAGAGTCGTCCGTCGGTCAATATGAGGACTGGGGA
GGCCGGCAGGAAAAGAGGCTGGCCGAGGGTGCGAGGCGGGCCCGGAGCAGCCCGGAGCAGCCGTCGAGCCTTGGC
TGGGTCGGCAAAGCGAGGGCGAAGGCGGCAGATTTCCTGGAATGGGCGCAGCACTCGAAGCATCTGGACTTTGCT
CTCAAGCTCTCCATAGCCGTCTTCCTCGTCCTGTGGCCCGCCTTCGTGACCTCGTGGCATTCTTGGTACGCAGAG
GTCCGCGGTATCTGGGCCCCCATGCAGCTCATCCTCGTCTTCGACGTGGCCATCGGCACGTCCCTGTTCGGCTTT
GCCGTTCGACTCTTCGGCGTCGTCTTCGGCTGCGTCTTCGGCTTCCTCGCCTACGAGATCGGCCGCGGCAACCGG
ATCGCCGTGGCGGCCGTCCTGGCCTTTGGGCTCGTGCCGTCCATCTACATCCAGGTGGCTACCAAGTATGCTAAG
GCCGGCATGGTCTCCATCGTGTCGATGACCGTCGTCGCCATCGGTAAGTCGCCCCGCCCGTCAGCCGTTGCACAG
GGGAAAGGCTCACAGCGGTCTGTCCAGCGTCCGTGA
Transcript >Hirsu2|1435
ATGGCGCCTCCCATGCCGCGCCGCAGCCTGGTCCTCATGATATGGGGATCCTGCGAGGCTAACGACCTCTGGCAG
CGCATCCTCAAGTATTCCATCGCCTGCATCGCCGCCGTCAGCATCGCCCTGCTCCCCGCCCTGCAGGACAAGTCC
GTCTTCCTCATCCCCATGGTCACCGTCTTCGCCCACCCCGGCCAGCGAATGGGCCTCATGATCGAGGCCTTGCTC
ATGGTCCTCCTCGGCTCTCTTCTCGGCCTGGCCTGGGCCTTGCTGGGCCTCTACCTGGCCAGCCTTGTCGACGAC
TCCAACCCGGCCGCCGCCTACACCATCCGCGCCCTCTTCTTTCTCCTCTGCCTGCTCGTCCATGGCTACCTGAGG
TCGTCGAACCCTCGAATCCTCATCTTTGTCCTCTACCTCGTCATCGCAAATCTCTTGACCATTCAGCTGCCGACC
GACACAACCAGCGCCCTCTTCACTTCAATCTACATCCCTGTCCTCATTGGCGCCGGCATCTTGCTCCTGGTCAAC
CTCGCCATCTTCCGAGAACTCTCCAGCAGCTATCTGGGCCTCTCAACCATCAACTCCCTGTCGGAAACCGTCGAC
ACCCTGACGCGCGCAACCCACTGGTTTGTCACTCCGGGTGGCGATGCTGTCGACAACAGGCCCAGGCCACCTTTG
CTCGCCCCGACTCTGACGGCGGGTGGCAGCATCCCCGAAAAGCAAGCCAAGAAGCATCGAATCAGACAATTCTTC
TCCCAGTTCCCCAACCCCTTCCACACGGTCAAGGCTCGCTCCGCCTTGGCTTCTGTTCCTCTGCCTTCCACCAAG
CTGGTTCATCTGACGGAACAGAAACCTAGGCTTCGCGCCCAGCTTGGCCGCTGTCAGGCGGCTCAGGAAGAAGTC
AACTTCGAGGCTTTCCTCTCGCCTCTGCCCCCGACCGCGCTGAAGCCCATCAGCATCCAACACATGACGGGCATC
GTCAAGAATGTCATCACTTTGATTGGTGCGTGCGAGAACAAGTTTGTCGTGGTGGAAAACGCTGCCGCCAGCGTC
GGCTTGTCGGGATCCGACAAGAAACCAGACTCACCAGTCACTCCGGAATCGAGACCAGGGAGCCCGAAGCCGGCC
ACCGACGGAGAATCGGGCGCTGAGGATCGAAAACCGAGGAAGAAGAAGAAGAAGAGGCCTCGTTTGAACAAGGTA
CACAGCGTCAAACCCGTCAAAGAACTCGAGGCCAGCAGTGCCCAGCTGCTGGAATCGATCCTCGCCCGGATTCGG
GGTCCCGTGCAACAGTTCCAAATCTCCTTGACAGAGGCTTCCAATCTAGTCATAATGTGTCTTGCCTATTGTTTC
GACGTGTCGACGTTACCCTCGGGCGCTCGGGCGCCCAGAGGCATACCGTTGGAGGAGATTGACCTGCGAATCGAC
CAATTCGCTCGTTCGCTCGCCGTTTTTGATTCGACGTCGGCCGAACAGCTCAAGCAGGCCACCATGGACCAGTCT
TGCCAGTCGGTTGACTTCATGCCCGGCATGGAGACCTTTCTGGTATCGTCCTTCATCCTGGCCTTTCGGGACTCT
GCGGAGCAGCTGCTGGACATGTTACACCACGCGCGACGCCTCATCGAGAAGAGGCAACTGCGCCGCGACCGGTCG
CGTCTCTGGTTCCCGCAGTACGCCAGTCTCCGCCGGCGGCTGGCGCCCAGAGCCGGCGATGCGCCATGTTCCTCC
GAAGTGTCCGAGAAGGCGCAGCGCGCGGCCGCGGATGATGGAGACGGGAGAAATCCTTCTCGCGCAAGAGAGACG
CGGGCGGCTGGCGAGTTCCGCTCCCGCCGAAATGCAGATGAAGAGTCGTCCGTCGGTCAATATGAGGACTGGGGA
GGCCGGCAGGAAAAGAGGCTGGCCGAGGGTGCGAGGCGGGCCCGGAGCAGCCCGGAGCAGCCGTCGAGCCTTGGC
TGGGTCGGCAAAGCGAGGGCGAAGGCGGCAGATTTCCTGGAATGGGCGCAGCACTCGAAGCATCTGGACTTTGCT
CTCAAGCTCTCCATAGCCGTCTTCCTCGTCCTGTGGCCCGCCTTCGTGACCTCGTGGCATTCTTGGTACGCAGAG
GTCCGCGGTATCTGGGCCCCCATGCAGCTCATCCTCGTCTTCGACGTGGCCATCGGCACGTCCCTGTTCGGCTTT
GCCGTTCGACTCTTCGGCGTCGTCTTCGGCTGCGTCTTCGGCTTCCTCGCCTACGAGATCGGCCGCGGCAACCGG
ATCGCCGTGGCGGCCGTCCTGGCCTTTGGGCTCGTGCCGTCCATCTACATCCAGGTGGCTACCAAGTATGCTAAG
GCCGGCATGGTCTCCATCGTGTCGATGACCGTCGTCGCCATCGGTAAGTCGCCCCGCCCGTCAGCCGTTGCACAG
GGGAAAGGCTCACAGCGGTCTGTCCAGCGTCCGTGA
Gene >Hirsu2|1435
ATGGCGCCTCCCATGCCGCGCCGCAGCCTGGTCCTCATGATATGGGGATCCTGCGAGGCTAACGACCTCTGGCAG
CGCATCCTCAAGTATTCCATCGCCTGCATCGCCGCCGTCAGCATCGCCCTGCTCCCCGCCCTGCAGGACAAGTCC
GTCTTCCTCATCCCCATGGTCACCGTCTTCGCCCACCCCGGCCAGCGAATGGGCCTCATGATCGAGGCCTTGCTC
ATGGTCCTCCTCGGCTCTCTTCTCGGCCTGGCCTGGGCCTTGCTGGGCCTCTACCTGGCCAGCCTTGTCGACGAC
TCCAACCCGGCCGCCGCCTACACCATCCGCGCCCTCTTCTTTCTCCTCTGCCTGCTCGTCCATGGCTACCTGAGG
TCGTCGAACCCTCGAATCCTCATCTTTGTCCTCTACCTCGTCATCGCAAATCTCTTGACCATTCAGCTGCCGACC
GACACAACCAGCGCCCTCTTCACTTCAATCTACATCCCTGTCCTCATTGGCGCCGGCATCTTGCTCCTGGTCAAC
CTCGCCATCTTCCGAGAACTCTCCAGCAGCTATCTGGGCCTCTCAACCATCAACTCCCTGTCGGAAACCGTCGAC
ACCCTGACGCGCGCAACCCACTGGTTTGTCACTCCGGGTGGCGATGCTGTCGACAACAGGCCCAGGCCACCTTTG
CTCGCCCCGACTCTGACGGCGGGTGGCAGCATCCCCGAAAAGCAAGCCAAGAAGCATCGAATCAGACAATTCTTC
TCCCAGTTCCCCAACCCCTTCCACACGGTCAAGGCTCGCTCCGCCTTGGCTTCTGTTCCTCTGCCTTCCACCAAG
CTGGTTCATCTGACGGAACAGAAACCTAGGCTTCGCGCCCAGCTTGGCCGCTGTCAGGCGGCTCAGGAAGAAGTC
AACTTCGAGGCTTTCCTCTCGCCTCTGCCCCCGACCGCGCTGAAGCCCATCAGCATCCAACACATGACGGGCATC
GTCAAGAATGTCATCACTTTGATTGGTGCGTGCGAGAACAAGTTTGTCGTGGTGGAAAACGCTGCCGCCAGCGTC
GGCTTGTCGGGATCCGACAAGAAACCAGACTCACCAGTCACTCCGGAATCGAGACCAGGGAGCCCGAAGCCGGCC
ACCGACGGAGAATCGGGCGCTGAGGATCGAAAACCGAGGAAGAAGAAGAAGAAGAGGCCTCGTTTGAACAAGGTA
CACAGCGTCAAACCCGTCAAAGAACTCGAGGCCAGCAGTGCCCAGCTGCTGGAATCGATCCTCGCCCGGATTCGG
GGTCCCGTGCAACAGTTCCAAATCTCCTTGACAGAGGCTTCCAATCTAGTCATAATGTGTCTTGCCTATTGTTTC
GACGTGTCGACGTTACCCTCGGGCGCTCGGGCGCCCAGAGGCATACCGTTGGAGGAGATTGACCTGCGAATCGAC
CAATTCGCTCGTTCGCTCGCCGTTTTTGATTCGACGTCGGCCGAACAGCTCAAGCAGGCCACCATGGACCAGTCT
TGCCAGTCGGTTGACTTCATGCCCGGCATGGAGACCTTTCTGGTATCGTCCTTCATCCTGGCCTTTCGGGACTCT
GCGGAGCAGCTGCTGGACATGTTACACCACGCGCGACGCCTCATCGAGAAGAGGCAACTGCGCCGCGACCGGTCG
CGTCTCTGGTTCCCGCAGTACGCCAGTCTCCGCCGGCGGCTGGCGCCCAGAGCCGGCGATGCGCCATGTTCCTCC
GAAGTGTCCGAGAAGGCGCAGCGCGCGGCCGCGGATGATGGAGACGGGAGAAATCCTTCTCGCGCAAGAGAGACG
CGGGCGGCTGGCGAGTTCCGCTCCCGCCGAAATGCAGATGAAGAGTCGTCCGTCGGTCAATATGAGGACTGGGGA
GGCCGGCAGGAAAAGAGGCTGGCCGAGGGTGCGAGGCGGGCCCGGAGCAGCCCGGAGCAGCCGTCGAGCCTTGGC
TGGGTCGGCAAAGCGAGGGCGAAGGCGGCAGATTTCCTGGAATGGGCGCAGCACTCGAAGCATCTGGACTTTGCT
CTCAAGCTCTCCATAGCCGTCTTCCTCGTCCTGTGGCCCGCCTTCGTGACCTCGTGGCATTCTTGGTACGCAGAG
GTCCGCGGTATCTGGGCCCCCATGCAGCTCATCCTCGTCTTCGACGTGGCCATCGGCACGTCCCTGTTCGGCTTT
GCCGTTCGACTCTTCGGCGTCGTCTTCGGCTGCGTCTTCGGCTTCCTCGCCTACGAGATCGGCCGCGGCAACCGG
ATCGCCGTGGCGGCCGTCCTGGCCTTTGGGCTCGTGCCGTCCATCTACATCCAGGTGGCTACCAAGTATGCTAAG
GCCGGCATGGTCTCCATCGTGTCGATGACCGTCGTCGCCATCGGTAAGTCGCCCCGCCCGTCAGCCGTTGCACAG
GGGAAAGGCTCACAGCGGTCTGTCCAGCGTCCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail