Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1431
Gene name
LocationContig_1312:192..3273
Strand-
Gene length (bp)3081
Transcript length (bp)2844
Coding sequence length (bp)2844
Protein length (aa) 948

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04950 RIBIOP_C 40S ribosome biogenesis protein Tsr1 and BMS1 C-terminal 8.8E-70 683 946
PF08142 AARP2CN AARP2CN (NUC121) domain 4.8E-26 214 301

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08965|BMS1_YEAST Ribosome biogenesis protein BMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMS1 PE=1 SV=1 3 946 0.0E+00
sp|O94653|BMS1_SCHPO Ribosome biogenesis protein bms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bms1 PE=1 SV=2 19 946 0.0E+00
sp|Q14692|BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens GN=BMS1 PE=1 SV=1 22 349 1.0E-98
sp|Q14692|BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens GN=BMS1 PE=1 SV=1 484 945 1.0E-78
sp|Q5VTM2|AGAP9_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9 OS=Homo sapiens GN=AGAP9 PE=3 SV=2 106 195 9.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08965|BMS1_YEAST Ribosome biogenesis protein BMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMS1 PE=1 SV=1 3 946 0.0E+00
sp|O94653|BMS1_SCHPO Ribosome biogenesis protein bms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bms1 PE=1 SV=2 19 946 0.0E+00
sp|Q14692|BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens GN=BMS1 PE=1 SV=1 22 349 1.0E-98
sp|Q14692|BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens GN=BMS1 PE=1 SV=1 484 945 1.0E-78
sp|Q5VTM2|AGAP9_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9 OS=Homo sapiens GN=AGAP9 PE=3 SV=2 106 195 9.0E-25
sp|Q5XGY1|TSR1_XENLA Pre-rRNA-processing protein TSR1 homolog OS=Xenopus laevis GN=tsr1 PE=2 SV=1 759 944 6.0E-19
sp|Q5SWD9|TSR1_MOUSE Pre-rRNA-processing protein TSR1 homolog OS=Mus musculus GN=Tsr1 PE=1 SV=1 736 944 5.0E-15
sp|Q9VP47|TSR1_DROME Pre-rRNA-processing protein TSR1 homolog OS=Drosophila melanogaster GN=CG7338 PE=1 SV=1 746 946 2.0E-13
sp|Q2NL82|TSR1_HUMAN Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens GN=TSR1 PE=1 SV=1 787 944 3.0E-13
sp|Q5R434|TSR1_PONAB Pre-rRNA-processing protein TSR1 homolog OS=Pongo abelii GN=TSR1 PE=2 SV=1 760 944 2.0E-12
sp|Q54YA7|TSR1_DICDI Pre-rRNA-processing protein TSR1 homolog OS=Dictyostelium discoideum GN=tsr1 PE=3 SV=1 746 944 9.0E-12
sp|O13956|TSR1_SCHPO Ribosome biogenesis protein tsr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsr1 PE=3 SV=1 762 944 2.0E-11
sp|Q5XGY1|TSR1_XENLA Pre-rRNA-processing protein TSR1 homolog OS=Xenopus laevis GN=tsr1 PE=2 SV=1 3 303 4.0E-09
sp|Q07381|TSR1_YEAST Ribosome biogenesis protein TSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSR1 PE=1 SV=1 785 944 4.0E-08
sp|Q61WR2|TSR1_CAEBR Pre-rRNA-processing protein TSR1 homolog OS=Caenorhabditis briggsae GN=tag-151 PE=3 SV=1 756 944 6.0E-07
sp|Q61WR2|TSR1_CAEBR Pre-rRNA-processing protein TSR1 homolog OS=Caenorhabditis briggsae GN=tag-151 PE=3 SV=1 64 367 5.0E-06
sp|Q9VP47|TSR1_DROME Pre-rRNA-processing protein TSR1 homolog OS=Drosophila melanogaster GN=CG7338 PE=1 SV=1 94 301 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0042254 ribosome biogenesis Yes
GO:0044085 cellular component biogenesis No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No
GO:0044424 intracellular part No
GO:0022613 ribonucleoprotein complex biogenesis No
GO:0071840 cellular component organization or biogenesis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1431
MEEQVHKPHRKSKEKKKHTGDRNPKAFAFSHPGKLQRTAARSQDIKEKRLHVPLVDRLPDEAPPRLVAIVGPPGV
GKTTLLKSLIRRYAKETISDPQGPITVVASKKQRLTFVECPNQLEAMVDIAKVADIILLMIDGNYGFEMETMEFL
NILAATGMPGNVFGILTHLDLFRKPQALKDAKKRLKRRLWTELYQGAHLFYLSGVINGRYPDREVHNLSRFVSVM
KSPRPLVWRNSHPYTVIDSFRDITHPSKIEQDPNCDRSIVFSGYLRGTNFAAQGQRVHVAGLGDFTVASMEVLPD
PCPTPAMEQAMAKITGKTGRRRLDEKEKKLHAPMSDRSGLKIDGDAIWITREKGFTFDKDADGAERGEGEEMIIG
LQAERKLLGQTEDGVQLFSGGEKVKRVIDEEENTGRKSQRKARFAEQDDSDEEPADDDSDNDEGFISGSDQQGSG
SETEEARPRKLGRLFDTSRDDGMNIANGEDDIAFADSDSDLGSISGADEGTEEDEEIDSDEEAAALRWKDGLSEK
ARKLRGRRRAFHTGDLARYIYDDSLSLQDVLKRWRGEDDEPEEEDIEQDSDDEGFFKKTGQEQENLAEDRLIPLY
DYEHLAAKWTQEENVDVLRQRFTTASAGRNDDGDGEGGEGDDDDGGDDDDDAQSDEGDGVFEDLEAAETPQPQPQ
PAEDIAAERERNAKRKEELKMRFEEEDRDGFLNDKAKARREGGDVQEFGEDEWYEAQKATIQKQLDINREEFETL
DERQRAAVEGHRAGKYAKLVLDGVPAEFVARFDGRLPIVVGGLTATEDRWGFVQVRIKRHRWHKKILKTNDPLIV
SLGWRRFQTLPLYSISDSRTRNRMLKYTPEHMHCFGTFYGPLVAPSTGLVAFNSFAADTPGFRIAATGTVLGVDE
STEIVKKLKLTGAPYKVFKNTAFVRGMFGSALEVAKFEGAAIRTVCC*
Coding >Hirsu2|1431
ATGGAGGAGCAAGTCCACAAGCCTCATCGCAAGTCCAAGGAGAAGAAGAAGCACACGGGAGACCGCAACCCGAAA
GCCTTCGCCTTCTCCCATCCCGGCAAGCTCCAGAGGACTGCCGCACGCTCGCAGGATATCAAAGAGAAGCGTCTC
CATGTGCCTCTCGTCGACCGACTCCCCGATGAAGCCCCGCCACGCCTCGTCGCCATCGTCGGGCCCCCGGGCGTC
GGCAAGACGACCCTCCTCAAGTCCCTGATCCGTCGATATGCCAAAGAGACAATCTCCGACCCCCAGGGCCCCATC
ACCGTCGTCGCCTCCAAGAAGCAGCGCCTGACGTTCGTCGAGTGCCCCAACCAGCTCGAGGCCATGGTCGATATC
GCAAAGGTGGCCGACATCATCCTGCTCATGATCGACGGAAACTACGGCTTCGAGATGGAGACGATGGAGTTTCTC
AACATCCTGGCCGCCACCGGCATGCCCGGCAACGTCTTCGGCATCCTGACCCACCTGGACCTGTTCCGCAAGCCC
CAGGCCCTCAAGGACGCCAAGAAGCGACTGAAGCGCAGGCTCTGGACAGAGCTGTACCAGGGCGCCCATCTCTTC
TACCTCTCCGGCGTCATCAACGGCCGCTACCCGGATCGCGAGGTCCACAACCTCTCCCGCTTCGTCTCCGTCATG
AAGAGCCCCCGGCCGCTGGTGTGGCGGAACTCGCACCCGTACACCGTCATCGACAGCTTTCGCGACATCACCCAT
CCCTCCAAGATCGAGCAAGATCCCAACTGCGACCGCTCCATCGTCTTCTCCGGCTACCTGCGGGGCACCAACTTT
GCAGCCCAGGGCCAGCGCGTCCACGTCGCCGGCCTGGGAGACTTCACCGTTGCGAGCATGGAGGTGCTGCCCGAC
CCCTGTCCCACCCCGGCCATGGAGCAAGCCATGGCGAAAATCACTGGCAAGACCGGCCGTCGGAGACTGGACGAG
AAGGAAAAGAAGCTGCATGCGCCCATGTCGGACCGAAGTGGCCTGAAGATCGACGGCGATGCCATCTGGATCACG
AGAGAAAAGGGATTCACGTTCGACAAGGACGCGGACGGTGCCGAGCGGGGCGAAGGCGAGGAGATGATCATCGGC
CTGCAGGCGGAACGGAAGCTGCTCGGCCAGACGGAAGACGGCGTGCAGCTCTTCTCCGGCGGCGAAAAGGTGAAA
AGGGTGATCGACGAGGAGGAGAACACCGGCAGGAAATCCCAGCGAAAGGCCCGGTTTGCGGAGCAAGACGACTCG
GACGAGGAGCCGGCCGATGACGACAGCGACAACGACGAGGGCTTCATCAGCGGCAGCGATCAGCAAGGCTCCGGT
TCCGAGACAGAAGAAGCCCGGCCCAGAAAGCTTGGCAGATTATTTGATACGTCCCGCGACGATGGCATGAACATC
GCCAACGGCGAGGATGATATTGCCTTTGCCGACAGCGACTCGGACCTTGGCTCCATCTCGGGCGCCGACGAGGGC
ACGGAAGAAGACGAGGAAATCGACTCGGACGAGGAGGCCGCCGCGCTGCGATGGAAAGATGGTCTGAGCGAAAAG
GCCAGGAAGCTCCGCGGCAGAAGACGCGCGTTCCACACCGGTGATCTCGCAAGGTACATCTACGACGACTCCCTC
AGCCTGCAGGACGTTCTCAAGAGGTGGAGAGGCGAGGATGACGAGCCCGAGGAGGAAGACATCGAACAGGATTCC
GACGACGAGGGCTTCTTCAAGAAGACGGGACAGGAGCAAGAAAATCTGGCCGAGGACAGGCTGATACCCTTGTAC
GACTACGAGCACCTGGCCGCCAAGTGGACACAGGAGGAGAATGTGGACGTGCTGCGCCAGAGATTCACAACGGCA
AGTGCCGGGAGGAATGATGACGGGGACGGGGAAGGCGGGGAAGGCGACGACGACGATGGCGGCGACGACGACGAC
GACGCGCAGAGCGACGAGGGCGACGGCGTCTTCGAGGACCTGGAGGCCGCCGAAACGCCGCAGCCGCAGCCGCAG
CCGGCCGAAGACATCGCGGCGGAGCGCGAGAGGAATGCGAAGCGGAAGGAGGAGCTCAAGATGCGGTTCGAAGAG
GAGGACAGGGACGGCTTCCTCAACGACAAGGCCAAGGCGCGGCGGGAGGGCGGGGACGTGCAGGAGTTCGGCGAG
GACGAGTGGTACGAGGCGCAGAAGGCGACGATCCAGAAGCAGCTGGACATCAACCGCGAGGAGTTCGAGACGCTG
GACGAGCGGCAGCGGGCGGCGGTGGAGGGCCACCGGGCCGGCAAGTACGCCAAGCTGGTGCTGGACGGGGTGCCG
GCCGAGTTCGTGGCCCGGTTCGACGGGCGGCTGCCGATCGTCGTGGGCGGGCTGACGGCGACGGAGGACCGGTGG
GGCTTCGTGCAGGTGCGCATCAAGCGGCACCGGTGGCACAAGAAGATACTCAAGACCAACGACCCGCTGATCGTG
TCGCTCGGCTGGCGGCGCTTCCAGACGCTGCCGCTCTACAGCATCTCGGACTCGCGGACGCGCAACCGGATGCTC
AAGTACACGCCGGAGCACATGCACTGCTTCGGCACCTTCTACGGCCCGCTGGTGGCGCCGAGCACCGGCCTCGTC
GCCTTCAACTCGTTCGCGGCCGACACGCCGGGCTTCCGGATCGCGGCCACGGGCACGGTGCTCGGCGTCGACGAG
TCGACCGAGATCGTCAAGAAGCTCAAGCTGACGGGCGCGCCGTACAAGGTGTTCAAGAACACGGCCTTCGTCCGC
GGCATGTTCGGCTCGGCGCTCGAGGTGGCCAAGTTCGAGGGCGCCGCGATCCGGACCGTGTGCTGCTGA
Transcript >Hirsu2|1431
ATGGAGGAGCAAGTCCACAAGCCTCATCGCAAGTCCAAGGAGAAGAAGAAGCACACGGGAGACCGCAACCCGAAA
GCCTTCGCCTTCTCCCATCCCGGCAAGCTCCAGAGGACTGCCGCACGCTCGCAGGATATCAAAGAGAAGCGTCTC
CATGTGCCTCTCGTCGACCGACTCCCCGATGAAGCCCCGCCACGCCTCGTCGCCATCGTCGGGCCCCCGGGCGTC
GGCAAGACGACCCTCCTCAAGTCCCTGATCCGTCGATATGCCAAAGAGACAATCTCCGACCCCCAGGGCCCCATC
ACCGTCGTCGCCTCCAAGAAGCAGCGCCTGACGTTCGTCGAGTGCCCCAACCAGCTCGAGGCCATGGTCGATATC
GCAAAGGTGGCCGACATCATCCTGCTCATGATCGACGGAAACTACGGCTTCGAGATGGAGACGATGGAGTTTCTC
AACATCCTGGCCGCCACCGGCATGCCCGGCAACGTCTTCGGCATCCTGACCCACCTGGACCTGTTCCGCAAGCCC
CAGGCCCTCAAGGACGCCAAGAAGCGACTGAAGCGCAGGCTCTGGACAGAGCTGTACCAGGGCGCCCATCTCTTC
TACCTCTCCGGCGTCATCAACGGCCGCTACCCGGATCGCGAGGTCCACAACCTCTCCCGCTTCGTCTCCGTCATG
AAGAGCCCCCGGCCGCTGGTGTGGCGGAACTCGCACCCGTACACCGTCATCGACAGCTTTCGCGACATCACCCAT
CCCTCCAAGATCGAGCAAGATCCCAACTGCGACCGCTCCATCGTCTTCTCCGGCTACCTGCGGGGCACCAACTTT
GCAGCCCAGGGCCAGCGCGTCCACGTCGCCGGCCTGGGAGACTTCACCGTTGCGAGCATGGAGGTGCTGCCCGAC
CCCTGTCCCACCCCGGCCATGGAGCAAGCCATGGCGAAAATCACTGGCAAGACCGGCCGTCGGAGACTGGACGAG
AAGGAAAAGAAGCTGCATGCGCCCATGTCGGACCGAAGTGGCCTGAAGATCGACGGCGATGCCATCTGGATCACG
AGAGAAAAGGGATTCACGTTCGACAAGGACGCGGACGGTGCCGAGCGGGGCGAAGGCGAGGAGATGATCATCGGC
CTGCAGGCGGAACGGAAGCTGCTCGGCCAGACGGAAGACGGCGTGCAGCTCTTCTCCGGCGGCGAAAAGGTGAAA
AGGGTGATCGACGAGGAGGAGAACACCGGCAGGAAATCCCAGCGAAAGGCCCGGTTTGCGGAGCAAGACGACTCG
GACGAGGAGCCGGCCGATGACGACAGCGACAACGACGAGGGCTTCATCAGCGGCAGCGATCAGCAAGGCTCCGGT
TCCGAGACAGAAGAAGCCCGGCCCAGAAAGCTTGGCAGATTATTTGATACGTCCCGCGACGATGGCATGAACATC
GCCAACGGCGAGGATGATATTGCCTTTGCCGACAGCGACTCGGACCTTGGCTCCATCTCGGGCGCCGACGAGGGC
ACGGAAGAAGACGAGGAAATCGACTCGGACGAGGAGGCCGCCGCGCTGCGATGGAAAGATGGTCTGAGCGAAAAG
GCCAGGAAGCTCCGCGGCAGAAGACGCGCGTTCCACACCGGTGATCTCGCAAGGTACATCTACGACGACTCCCTC
AGCCTGCAGGACGTTCTCAAGAGGTGGAGAGGCGAGGATGACGAGCCCGAGGAGGAAGACATCGAACAGGATTCC
GACGACGAGGGCTTCTTCAAGAAGACGGGACAGGAGCAAGAAAATCTGGCCGAGGACAGGCTGATACCCTTGTAC
GACTACGAGCACCTGGCCGCCAAGTGGACACAGGAGGAGAATGTGGACGTGCTGCGCCAGAGATTCACAACGGCA
AGTGCCGGGAGGAATGATGACGGGGACGGGGAAGGCGGGGAAGGCGACGACGACGATGGCGGCGACGACGACGAC
GACGCGCAGAGCGACGAGGGCGACGGCGTCTTCGAGGACCTGGAGGCCGCCGAAACGCCGCAGCCGCAGCCGCAG
CCGGCCGAAGACATCGCGGCGGAGCGCGAGAGGAATGCGAAGCGGAAGGAGGAGCTCAAGATGCGGTTCGAAGAG
GAGGACAGGGACGGCTTCCTCAACGACAAGGCCAAGGCGCGGCGGGAGGGCGGGGACGTGCAGGAGTTCGGCGAG
GACGAGTGGTACGAGGCGCAGAAGGCGACGATCCAGAAGCAGCTGGACATCAACCGCGAGGAGTTCGAGACGCTG
GACGAGCGGCAGCGGGCGGCGGTGGAGGGCCACCGGGCCGGCAAGTACGCCAAGCTGGTGCTGGACGGGGTGCCG
GCCGAGTTCGTGGCCCGGTTCGACGGGCGGCTGCCGATCGTCGTGGGCGGGCTGACGGCGACGGAGGACCGGTGG
GGCTTCGTGCAGGTGCGCATCAAGCGGCACCGGTGGCACAAGAAGATACTCAAGACCAACGACCCGCTGATCGTG
TCGCTCGGCTGGCGGCGCTTCCAGACGCTGCCGCTCTACAGCATCTCGGACTCGCGGACGCGCAACCGGATGCTC
AAGTACACGCCGGAGCACATGCACTGCTTCGGCACCTTCTACGGCCCGCTGGTGGCGCCGAGCACCGGCCTCGTC
GCCTTCAACTCGTTCGCGGCCGACACGCCGGGCTTCCGGATCGCGGCCACGGGCACGGTGCTCGGCGTCGACGAG
TCGACCGAGATCGTCAAGAAGCTCAAGCTGACGGGCGCGCCGTACAAGGTGTTCAAGAACACGGCCTTCGTCCGC
GGCATGTTCGGCTCGGCGCTCGAGGTGGCCAAGTTCGAGGGCGCCGCGATCCGGACCGTGTGCTGCTGA
Gene >Hirsu2|1431
ATGGAGGAGCAAGTCCACAAGCCTCATCGCAAGTCCAAGGAGAAGAAGAAGCACACGGGAGGTATTTTTCGCCCT
TGTCCCTCCCCGACCGCTCCACCAGAGCGCCCGGCTGACGAGGACCTACCCAGACCGCAACCCGAAAGCCTTCGC
CTTCTCCCATCCCGGCAAGCTCCAGAGGACTGCCGCACGCTCGCAGGATGTGAGGCTCCCGCTCGCCCAAGCGCG
TTGGCTTCTTGCCGCTCGCGCTTCCCCGCCCGTCCCTCGCTCTGACCCTCTGCCCTTGTCCCGTCCAGATCAAAG
AGAAGCGTCTCCATGTGCCTCTCGTCGACCGACTCCCCGATGAAGCCCCGCCACGCCTCGTCGCCATCGTCGGGC
CCCCGGGCGTCGGCAAGACGACCCTCCTCAAGTCCCTGATCCGTCGATATGCCAAAGAGACAATCTCCGACCCCC
AGGGCCCCATCACCGTCGTCGCCTCCAAGAAGCAGCGCCTGACGTTCGTCGAGTGCCCCAACCAGCTCGAGGCCA
TGGTCGATATCGCAAAGGTGGCCGACATCATCCTGCTCATGATCGACGGAAACTACGGCTTCGAGATGGAGACGA
TGGAGTTTCTCAACATCCTGGCCGCCACCGGCATGCCCGGCAACGTCTTCGGCATCCTGACCCACCTGGACCTGT
TCCGCAAGCCCCAGGCCCTCAAGGACGCCAAGAAGCGACTGAAGCGCAGGCTCTGGACAGAGCTGTACCAGGGCG
CCCATCTCTTCTACCTCTCCGGCGTCATCAACGGCCGCTACCCGGATCGCGAGGTCCACAACCTCTCCCGCTTCG
TCTCCGTCATGAAGAGCCCCCGGCCGCTGGTGTGGCGGAACTCGCACCCGTACACCGTCATCGACAGCTTTCGCG
ACATCACCCATCCCTCCAAGATCGAGCAAGATCCCAACTGCGACCGCTCCATCGTCTTCTCCGGCTACCTGCGGG
GCACCAACTTTGCAGCCCAGGGCCAGCGCGTCCACGTCGCCGGCCTGGGAGACTTCACCGTTGCGAGCATGGAGG
TGCTGCCCGACCCCTGTCCCACCCCGGCCATGGAGCAAGCCATGGCGAAAATCACTGGCAAGACCGGCCGTCGGA
GACTGGACGAGAAGGAAAAGAAGCTGCATGCGCCCATGTCGGACCGAAGTGGCCTGAAGATCGACGGCGATGCCA
TCTGGATCACGAGAGAAAAGGGATTCACGTTCGACAAGGACGCGGACGGTGCCGAGCGGGGCGAAGGCGAGGAGA
TGATCATCGGCCTGCAGGCGGAACGGAAGCTGCTCGGCCAGACGGAAGACGGCGTGCAGCTCTTCTCCGGCGGCG
AAAAGGTGAAAAGGGTGATCGACGAGGAGGAGAACACCGGCAGGAAATCCCAGCGAAAGGCCCGGTTTGCGGAGC
AAGACGACTCGGACGAGGAGCCGGCCGATGACGACAGCGACAACGACGAGGGCTTCATCAGCGGCAGCGATCAGC
AAGGCTCCGGTTCCGAGACAGAAGAAGCCCGGCCCAGAAAGCTTGGCAGATTATTTGATACGTCCCGCGACGATG
GCATGAACATCGCCAACGGCGAGGATGATATTGCCTTTGCCGACAGCGACTCGGACCTTGGCTCCATCTCGGGCG
CCGACGAGGGCACGGAAGAAGACGAGGAAATCGACTCGGACGAGGAGGCCGCCGCGCTGCGATGGAAAGATGGTC
TGAGCGAAAAGGCCAGGAAGCTCCGCGGCAGAAGACGCGCGTTCCACACCGGTGATCTCGCAAGGTACATCTACG
ACGACTCCCTCAGCCTGCAGGACGTTCTCAAGAGGTGGAGAGGCGAGGATGACGAGCCCGAGGAGGAAGACATCG
AACAGGATTCCGACGACGAGGGCTTCTTCAAGAAGACGGGACAGGAGCAAGAAAATCTGGCCGAGGACAGGCTGA
TACCCTTGTACGACTACGAGCACCTGGCCGCCAAGTGGACACAGGAGGAGAATGTGGACGTGCTGCGCCAGAGAT
TCACAACGGCAAGTGCCGGGAGGAATGATGACGGGGACGGGGAAGGCGGGGAAGGCGACGACGACGATGGCGGCG
ACGACGACGACGACGCGCAGAGCGACGAGGGCGACGGCGTCTTCGAGGACCTGGAGGCCGCCGAAACGCCGCAGC
CGCAGCCGCAGCCGGCCGAAGACATCGCGGCGGAGCGCGAGAGGAATGCGAAGCGGAAGGAGGAGCTCAAGATGC
GGTTCGAAGAGGAGGACAGGGACGGCTTCCTCAACGACAAGGCCAAGGCGCGGCGGGAGGGCGGGGACGTGCAGG
AGTTCGGCGAGGACGAGTGGTACGAGGCGCAGAAGGCGACGATCCAGAAGCAGCTGGACATCAACCGCGAGGAGT
TCGAGACGCTGGACGAGCGGCAGCGGGCGGCGGTGGAGGGCCACCGGGCCGGCAAGTACGCCAAGCTGGTGCTGG
ACGGGGTGCCGGCCGAGTTCGTGGCCCGGTTCGACGGGCGGCTGCCGATCGTCGTGGGCGGGCTGACGGCGACGG
AGGACCGGTGGGGCTTCGTGCAGGTGCGCATCAAGCGGCACCGGTGGCACAAGAAGATACTCAAGACCAACGACC
CGCTGATCGTGTCGCTCGGCTGGCGGCGCTTCCAGACGCTGCCGCTCTACAGCATCTCGGACTCGCGGACGCGCA
ACCGGATGCTCAAGTACACGCCGGAGCACATGCACTGCTTCGGCACCTTCTACGGCCCGCTGGTGGCGCCGAGCA
CCGGCCTCGTCGCCTTCAACTCGTTCGCGGCCGACACGCCGGGCTTCCGGATCGCGGCCACGGGCACGGTGCTCG
GCGTCGACGAGTCGACCGAGATCGTCAAGAAGCTCAAGCTGACGGGCGCGCCGTACAAGGTGTTCAAGAACACGG
CCTTCGTCCGCGGCATGTTCGGCTCGGCGCTCGAGGTGGCCAAGTTCGAGGGCGCCGCGATCCGGACCGTGTCGG
GCGTGCGCGGCCAGATCAAGCGGGCGCTGGCCCGGCCCGAGGGCCACTTCCGCGCCACCTTCGAGGACAAGGTGC
TGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail