Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1419
Gene name
LocationContig_131:7454..11509
Strand+
Gene length (bp)4055
Transcript length (bp)3888
Coding sequence length (bp)3888
Protein length (aa) 1296

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 1.4E-50 1059 1286
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 2.3E-15 165 215
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 2.8E-06 619 957
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.4E-04 710 820

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 314 1294 0.0E+00
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 167 1292 0.0E+00
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 97 1292 0.0E+00
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 94 1292 0.0E+00
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 155 1292 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 314 1294 0.0E+00
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 167 1292 0.0E+00
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 97 1292 0.0E+00
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 94 1292 0.0E+00
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 155 1292 0.0E+00
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 155 1292 0.0E+00
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 167 1292 0.0E+00
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 167 1292 0.0E+00
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 322 1293 0.0E+00
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 171 1293 8.0E-115
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 85 1290 4.0E-110
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 164 1247 7.0E-110
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 164 1294 3.0E-108
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 142 1294 1.0E-104
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 142 1294 1.0E-104
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 168 1294 8.0E-102
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 135 1237 9.0E-102
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 150 1294 2.0E-100
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 167 1294 1.0E-99
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 163 1243 1.0E-99
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 167 1286 2.0E-98
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 137 1286 2.0E-97
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 152 1242 5.0E-97
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 122 1294 5.0E-97
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 163 1243 8.0E-97
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 167 1286 1.0E-96
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 167 1261 4.0E-95
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 167 1294 8.0E-95
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 323 1172 2.0E-94
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 323 1172 2.0E-94
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 323 1172 6.0E-94
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 318 1294 1.0E-93
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 168 1243 5.0E-92
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 152 1239 1.0E-91
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 318 1293 3.0E-91
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 379 1175 1.0E-90
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 314 1295 2.0E-90
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 314 1294 5.0E-89
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 162 1293 6.0E-88
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 165 1260 9.0E-88
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 168 1217 1.0E-87
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 168 1181 3.0E-87
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 318 1293 6.0E-87
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 165 1260 2.0E-85
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 162 1284 7.0E-85
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 321 1295 5.0E-82
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 321 1293 2.0E-78
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 727 1181 9.0E-67
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 116 941 1.0E-66
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 727 1286 2.0E-65
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 720 1238 1.0E-64
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 727 1238 2.0E-61
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 727 1238 7.0E-61
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 719 1244 2.0E-60
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 162 941 2.0E-59
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 162 991 4.0E-53
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 837 1259 4.0E-51
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 832 1286 5.0E-46
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 992 1286 2.0E-36
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 171 645 2.0E-32
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 992 1285 8.0E-30
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 153 256 8.0E-29
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 323 820 8.0E-29
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 152 649 2.0E-26
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 161 649 2.0E-25
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 166 257 2.0E-24
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 167 648 2.0E-24
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 603 1094 1.0E-17
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 603 1092 4.0E-17
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 513 1294 1.0E-16
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 513 1294 1.0E-16
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 604 1092 5.0E-16
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 318 648 5.0E-15
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 603 1235 5.0E-15
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 765 1099 5.0E-15
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 764 1064 2.0E-14
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 603 1235 3.0E-14
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 524 1095 6.0E-14
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 568 1181 8.0E-14
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 323 648 1.0E-13
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 763 1167 3.0E-13
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 603 1108 5.0E-13
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 615 1093 8.0E-13
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 765 1099 4.0E-12
sp|Q9LY77|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1 603 1092 8.0E-12
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 142 257 9.0E-12
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 774 1073 1.0E-10
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 137 257 7.0E-10
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 520 1092 8.0E-10
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 168 260 1.0E-09
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 149 257 1.0E-08
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 779 1064 1.0E-08
sp|Q92126|ATP4A_XENLA Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 479 1062 5.0E-08
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 149 257 1.0E-07
sp|P35315|ATC_TRYBB Probable calcium-transporting ATPase OS=Trypanosoma brucei brucei GN=TBA1 PE=3 SV=1 886 1103 1.0E-07
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 142 257 2.0E-07
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 562 1267 1.0E-06
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 769 1064 2.0E-06
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 773 1272 3.0E-06
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 773 1177 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 1122 1141 19
2 1171 1193 22
3 1203 1220 17
4 1227 1249 22
5 1253 1275 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1419
MPPSPPYRPTEPPDSPTHDSDSDLDLDFDELDPNPAEPPPSGPGRRQPTAEQSTSRIALRNLRMGGLRRANKRGR
EYGELGARRDDSDDHDGLAQSWSDGGGGPGGDDDVPLLGGDPRSHRRRESRGSLRLPSFMSKKADDAGSIEKSDD
DPSSSRLVAVGCAQATRFPANIVSNAKYTALTFLPVTLYNEFSFFFNMYFLLVALSQAIPALRIGYLSTYVAPLA
FVLLITMGKEAYDDIERRRRDTEANSEEYSVLVFGDPDLRPATLRPRRPLKSDSVRRGSRRSRGGRHDLSDIQEE
EEQDGAGAPQPSSHVMEVSRKSKDLKVGDVLKLSKGQRVPADVVILQCYITDGAATTPAKEPAEEEALLALADSE
QNQKGKQPVAEVLKDEAETGAVGETFIRTDQLDGETDWKLRLASPLTQNLPPEEFVRLLVTGGKPDKKVNEFVGT
VELRPTRQDAQSQHAVLQQEEDVSKSFALSIDNTAWANTVIASQGTTLAVIMYAGPQTRSALSTAPSRSKTGLLE
YEINSLTKILCALTLALSIVLVALQGFEKSGGNIWYIKIMRFLVLFSTIVPISLRVNLDMGKSAYSRFIQRDPGI
PGAVVRTSTIPEDLGRIEYLLSDKTGTLTQNDMEMKKIHVGTVSYANEAMDEVAVYVKQGFHIQPTTEPSSRTML
ITPSSTYSAAVNVGATRTRREIGSRVRDLVLALALCHNVTPTVDTEDGREVMSYQASSPDEIAIVKWTESVGLRL
SYRDRQNMTLEFTESRRPIVRVRILDVFPFTSDGKRMGIIVHFQDDLRAPKSDLKSGEIWFYQKGADTVMTSIVA
ANDWLDEETANMAREGLRTLVVGRKKLSVQQYLEFSSSHQEASLAIAGRDAGLQRVVSRHLESDLELLGVTGVED
KLQKDVKPSLELLRNAGIKIWMLTGDKVETARCVAVSSKLVARGQYIYTVAKLKKKDYARDHLDFLRSKTDACLL
IDGESLALLLTHFRMEFITVAVQLPTVVACRCSPTQKAEVAKLIREYTKKRVCCIGDGGNDVSMIQAADVGVGIV
GKEGRQASLAADFSIEQFCHLVKLLVWHGRNSYKRSAKLAQFVIHRGLIIAVCQTMYSIALKFEPEGLYKDWLLV
GYATVYTAAPVLSLVLDKDVDENVASLYPELYKELTSGRSLSYRTFFVWVFVSIYQGGMIQGLSQILTEVDGKKM
VAVSYTVLVLNELIMVAIEITTWHPVMIISILGTFLFFVGSMPFLGGYFDLEFLITWGFVWRILAIGAISLVPPY
AGKLIRRAIRPPSYRKVQDR*
Coding >Hirsu2|1419
ATGCCTCCTTCACCTCCGTACCGACCGACCGAGCCGCCCGATTCGCCCACGCATGACTCCGACTCCGATCTCGAC
CTTGACTTCGACGAGCTCGACCCCAATCCGGCCGAGCCGCCGCCATCCGGACCCGGCCGCCGCCAGCCGACGGCC
GAGCAGAGCACCTCGAGGATAGCACTGCGAAACTTGCGTATGGGAGGACTGCGCCGCGCCAACAAGCGTGGACGC
GAGTACGGGGAGCTCGGCGCCCGTCGCGACGACTCGGACGACCATGACGGACTCGCACAGTCCTGGTCCGACGGC
GGCGGAGGCCCCGGCGGCGACGACGATGTCCCGCTCCTGGGCGGCGATCCGCGCTCTCACCGCCGTCGCGAGTCC
CGCGGCAGCCTTCGACTGCCCAGCTTCATGTCCAAGAAGGCTGACGACGCCGGCTCTATCGAGAAGTCCGACGAC
GACCCCTCGTCGTCGAGGCTCGTCGCCGTCGGTTGCGCCCAGGCCACGCGCTTCCCCGCCAACATCGTCTCCAAC
GCCAAGTACACGGCTCTGACCTTCTTGCCCGTCACCCTGTACAATGAGTTCTCCTTTTTCTTCAACATGTACTTC
CTGCTCGTTGCTTTGTCGCAGGCGATACCCGCTCTGCGAATAGGCTACCTTTCGACCTATGTCGCCCCTCTGGCC
TTTGTCCTGCTCATCACCATGGGCAAGGAGGCCTACGACGACATCGAGAGGCGCCGCCGGGACACGGAGGCCAAC
TCGGAGGAGTACAGTGTGCTCGTATTCGGCGACCCCGACCTGCGTCCTGCTACGCTTCGGCCGCGTCGACCTCTG
AAATCCGACTCGGTCAGGCGTGGATCTCGAAGATCGAGGGGCGGGAGACACGACCTCTCCGACATCCAGGAGGAA
GAGGAGCAGGATGGAGCGGGAGCGCCTCAGCCGTCTTCTCATGTGATGGAAGTCAGCCGCAAATCGAAAGACCTC
AAAGTCGGCGACGTCCTGAAGCTGAGCAAGGGACAGCGGGTACCTGCGGATGTCGTCATCTTGCAGTGCTACATA
ACGGACGGTGCTGCCACCACTCCGGCCAAGGAACCGGCAGAAGAGGAGGCTTTGCTGGCCTTGGCCGACAGCGAG
CAGAACCAGAAGGGAAAGCAGCCCGTGGCCGAAGTGCTCAAAGACGAGGCAGAAACCGGCGCCGTCGGGGAGACG
TTCATCAGGACGGACCAGCTTGATGGCGAGACGGACTGGAAGCTGAGATTGGCCTCTCCCCTGACACAGAACCTG
CCGCCTGAAGAGTTTGTCCGCCTTCTCGTGACGGGCGGCAAGCCCGACAAGAAGGTCAATGAGTTTGTAGGGACT
GTCGAGCTGCGTCCCACGCGGCAGGATGCCCAGAGCCAACACGCCGTGCTCCAGCAGGAGGAAGATGTCTCCAAG
TCGTTCGCGCTGTCGATCGACAACACGGCATGGGCCAACACGGTCATCGCTTCGCAAGGCACAACCTTGGCCGTC
ATCATGTACGCGGGCCCGCAGACGCGGTCCGCCTTGTCGACTGCGCCCTCGCGTTCCAAGACCGGACTGCTGGAA
TACGAGATCAACTCCTTGACGAAAATCCTATGCGCGCTGACGCTGGCGCTGTCTATCGTGCTCGTCGCTCTCCAG
GGCTTCGAGAAGTCCGGGGGCAACATCTGGTACATTAAAATTATGCGCTTCCTCGTCCTTTTCTCGACCATTGTG
CCCATCAGCCTGCGCGTCAACCTGGACATGGGCAAGAGCGCGTATTCACGGTTCATCCAGCGCGACCCCGGCATT
CCGGGGGCTGTTGTCCGGACGAGCACCATCCCGGAAGATCTGGGGCGCATCGAGTACCTGCTCAGCGACAAGACG
GGAACTCTGACCCAGAATGACATGGAGATGAAGAAGATTCATGTAGGCACGGTCTCGTATGCCAACGAGGCGATG
GACGAGGTCGCCGTCTACGTCAAGCAAGGATTCCATATCCAACCCACCACCGAGCCGTCGTCCCGGACGATGCTC
ATCACCCCCTCGTCGACATATTCTGCTGCCGTCAATGTCGGCGCAACGCGCACGAGGAGGGAAATCGGATCGCGA
GTCCGTGATCTCGTCCTGGCTTTGGCGCTCTGCCATAACGTGACGCCCACGGTCGACACCGAAGATGGTCGAGAA
GTGATGTCGTACCAGGCATCGTCCCCAGACGAGATTGCAATAGTCAAGTGGACCGAGTCTGTTGGCCTGCGGCTA
TCGTACCGCGACCGCCAGAACATGACTCTGGAGTTTACAGAGAGCCGCCGGCCGATTGTGCGGGTCCGCATCCTC
GACGTCTTCCCTTTCACGTCGGACGGCAAGCGGATGGGCATCATTGTGCATTTCCAAGATGACCTCAGGGCGCCA
AAGTCCGACCTCAAGAGCGGCGAGATCTGGTTCTACCAGAAAGGCGCCGACACGGTCATGACCTCCATCGTCGCG
GCCAACGACTGGCTGGACGAGGAGACGGCCAACATGGCACGAGAGGGGTTGCGGACGCTCGTCGTGGGCCGCAAG
AAGCTATCCGTCCAGCAGTACCTAGAGTTCTCGTCCAGTCATCAGGAGGCCTCGCTGGCCATCGCCGGGCGCGAC
GCCGGGCTCCAGAGAGTGGTCTCGCGCCACCTCGAGAGCGACCTGGAGCTCCTGGGCGTGACGGGCGTGGAAGAC
AAGCTGCAGAAGGACGTCAAGCCGTCGCTGGAGCTCCTGCGCAACGCCGGCATCAAGATCTGGATGCTGACGGGC
GACAAGGTCGAGACGGCACGGTGCGTCGCGGTCAGCTCGAAGCTCGTCGCTAGAGGGCAGTACATCTACACCGTC
GCCAAGCTCAAGAAGAAGGACTACGCACGCGACCACCTCGACTTCCTGCGCAGCAAGACCGACGCCTGCCTGCTG
ATCGACGGCGAGAGCCTGGCCCTCCTGCTGACGCACTTCCGCATGGAGTTCATCACCGTCGCCGTCCAGCTGCCG
ACGGTGGTCGCCTGCCGCTGCTCTCCGACGCAGAAGGCCGAGGTGGCCAAGCTCATCAGGGAGTACACGAAGAAG
CGCGTGTGCTGCATAGGCGACGGCGGCAACGACGTGTCCATGATCCAGGCCGCGGACGTGGGCGTCGGCATCGTG
GGAAAGGAGGGGCGGCAGGCCAGCCTAGCGGCCGACTTCTCGATCGAGCAGTTCTGCCACCTGGTCAAGCTGCTC
GTGTGGCACGGGCGCAACAGCTACAAGCGGAGCGCGAAGCTGGCGCAGTTCGTCATCCACCGCGGCCTCATCATC
GCCGTCTGCCAGACCATGTACAGCATCGCGCTGAAATTCGAACCGGAAGGACTCTACAAGGACTGGCTTCTCGTC
GGCTACGCCACCGTCTACACGGCGGCCCCCGTCTTGTCCCTCGTTCTTGACAAGGACGTGGACGAGAACGTGGCC
AGCCTGTACCCAGAGCTGTACAAGGAGCTGACGTCCGGGCGGTCGTTGTCGTACCGCACCTTCTTCGTCTGGGTC
TTCGTATCCATCTACCAGGGCGGCATGATCCAGGGACTGTCGCAGATCCTGACCGAGGTGGACGGCAAGAAGATG
GTGGCCGTGAGCTACACGGTGCTCGTCCTCAACGAGCTCATCATGGTGGCCATCGAGATCACGACGTGGCATCCC
GTCATGATCATCAGCATCCTCGGCACCTTTCTCTTCTTTGTCGGGTCGATGCCCTTCCTCGGCGGCTACTTTGAC
CTCGAATTCCTCATTACGTGGGGCTTCGTGTGGCGCATCCTTGCCATCGGGGCCATCTCGCTCGTGCCTCCCTAC
GCCGGGAAGCTGATCCGGAGAGCCATCAGGCCTCCGTCGTACAGAAAGGTGCAGGACAGGTAG
Transcript >Hirsu2|1419
ATGCCTCCTTCACCTCCGTACCGACCGACCGAGCCGCCCGATTCGCCCACGCATGACTCCGACTCCGATCTCGAC
CTTGACTTCGACGAGCTCGACCCCAATCCGGCCGAGCCGCCGCCATCCGGACCCGGCCGCCGCCAGCCGACGGCC
GAGCAGAGCACCTCGAGGATAGCACTGCGAAACTTGCGTATGGGAGGACTGCGCCGCGCCAACAAGCGTGGACGC
GAGTACGGGGAGCTCGGCGCCCGTCGCGACGACTCGGACGACCATGACGGACTCGCACAGTCCTGGTCCGACGGC
GGCGGAGGCCCCGGCGGCGACGACGATGTCCCGCTCCTGGGCGGCGATCCGCGCTCTCACCGCCGTCGCGAGTCC
CGCGGCAGCCTTCGACTGCCCAGCTTCATGTCCAAGAAGGCTGACGACGCCGGCTCTATCGAGAAGTCCGACGAC
GACCCCTCGTCGTCGAGGCTCGTCGCCGTCGGTTGCGCCCAGGCCACGCGCTTCCCCGCCAACATCGTCTCCAAC
GCCAAGTACACGGCTCTGACCTTCTTGCCCGTCACCCTGTACAATGAGTTCTCCTTTTTCTTCAACATGTACTTC
CTGCTCGTTGCTTTGTCGCAGGCGATACCCGCTCTGCGAATAGGCTACCTTTCGACCTATGTCGCCCCTCTGGCC
TTTGTCCTGCTCATCACCATGGGCAAGGAGGCCTACGACGACATCGAGAGGCGCCGCCGGGACACGGAGGCCAAC
TCGGAGGAGTACAGTGTGCTCGTATTCGGCGACCCCGACCTGCGTCCTGCTACGCTTCGGCCGCGTCGACCTCTG
AAATCCGACTCGGTCAGGCGTGGATCTCGAAGATCGAGGGGCGGGAGACACGACCTCTCCGACATCCAGGAGGAA
GAGGAGCAGGATGGAGCGGGAGCGCCTCAGCCGTCTTCTCATGTGATGGAAGTCAGCCGCAAATCGAAAGACCTC
AAAGTCGGCGACGTCCTGAAGCTGAGCAAGGGACAGCGGGTACCTGCGGATGTCGTCATCTTGCAGTGCTACATA
ACGGACGGTGCTGCCACCACTCCGGCCAAGGAACCGGCAGAAGAGGAGGCTTTGCTGGCCTTGGCCGACAGCGAG
CAGAACCAGAAGGGAAAGCAGCCCGTGGCCGAAGTGCTCAAAGACGAGGCAGAAACCGGCGCCGTCGGGGAGACG
TTCATCAGGACGGACCAGCTTGATGGCGAGACGGACTGGAAGCTGAGATTGGCCTCTCCCCTGACACAGAACCTG
CCGCCTGAAGAGTTTGTCCGCCTTCTCGTGACGGGCGGCAAGCCCGACAAGAAGGTCAATGAGTTTGTAGGGACT
GTCGAGCTGCGTCCCACGCGGCAGGATGCCCAGAGCCAACACGCCGTGCTCCAGCAGGAGGAAGATGTCTCCAAG
TCGTTCGCGCTGTCGATCGACAACACGGCATGGGCCAACACGGTCATCGCTTCGCAAGGCACAACCTTGGCCGTC
ATCATGTACGCGGGCCCGCAGACGCGGTCCGCCTTGTCGACTGCGCCCTCGCGTTCCAAGACCGGACTGCTGGAA
TACGAGATCAACTCCTTGACGAAAATCCTATGCGCGCTGACGCTGGCGCTGTCTATCGTGCTCGTCGCTCTCCAG
GGCTTCGAGAAGTCCGGGGGCAACATCTGGTACATTAAAATTATGCGCTTCCTCGTCCTTTTCTCGACCATTGTG
CCCATCAGCCTGCGCGTCAACCTGGACATGGGCAAGAGCGCGTATTCACGGTTCATCCAGCGCGACCCCGGCATT
CCGGGGGCTGTTGTCCGGACGAGCACCATCCCGGAAGATCTGGGGCGCATCGAGTACCTGCTCAGCGACAAGACG
GGAACTCTGACCCAGAATGACATGGAGATGAAGAAGATTCATGTAGGCACGGTCTCGTATGCCAACGAGGCGATG
GACGAGGTCGCCGTCTACGTCAAGCAAGGATTCCATATCCAACCCACCACCGAGCCGTCGTCCCGGACGATGCTC
ATCACCCCCTCGTCGACATATTCTGCTGCCGTCAATGTCGGCGCAACGCGCACGAGGAGGGAAATCGGATCGCGA
GTCCGTGATCTCGTCCTGGCTTTGGCGCTCTGCCATAACGTGACGCCCACGGTCGACACCGAAGATGGTCGAGAA
GTGATGTCGTACCAGGCATCGTCCCCAGACGAGATTGCAATAGTCAAGTGGACCGAGTCTGTTGGCCTGCGGCTA
TCGTACCGCGACCGCCAGAACATGACTCTGGAGTTTACAGAGAGCCGCCGGCCGATTGTGCGGGTCCGCATCCTC
GACGTCTTCCCTTTCACGTCGGACGGCAAGCGGATGGGCATCATTGTGCATTTCCAAGATGACCTCAGGGCGCCA
AAGTCCGACCTCAAGAGCGGCGAGATCTGGTTCTACCAGAAAGGCGCCGACACGGTCATGACCTCCATCGTCGCG
GCCAACGACTGGCTGGACGAGGAGACGGCCAACATGGCACGAGAGGGGTTGCGGACGCTCGTCGTGGGCCGCAAG
AAGCTATCCGTCCAGCAGTACCTAGAGTTCTCGTCCAGTCATCAGGAGGCCTCGCTGGCCATCGCCGGGCGCGAC
GCCGGGCTCCAGAGAGTGGTCTCGCGCCACCTCGAGAGCGACCTGGAGCTCCTGGGCGTGACGGGCGTGGAAGAC
AAGCTGCAGAAGGACGTCAAGCCGTCGCTGGAGCTCCTGCGCAACGCCGGCATCAAGATCTGGATGCTGACGGGC
GACAAGGTCGAGACGGCACGGTGCGTCGCGGTCAGCTCGAAGCTCGTCGCTAGAGGGCAGTACATCTACACCGTC
GCCAAGCTCAAGAAGAAGGACTACGCACGCGACCACCTCGACTTCCTGCGCAGCAAGACCGACGCCTGCCTGCTG
ATCGACGGCGAGAGCCTGGCCCTCCTGCTGACGCACTTCCGCATGGAGTTCATCACCGTCGCCGTCCAGCTGCCG
ACGGTGGTCGCCTGCCGCTGCTCTCCGACGCAGAAGGCCGAGGTGGCCAAGCTCATCAGGGAGTACACGAAGAAG
CGCGTGTGCTGCATAGGCGACGGCGGCAACGACGTGTCCATGATCCAGGCCGCGGACGTGGGCGTCGGCATCGTG
GGAAAGGAGGGGCGGCAGGCCAGCCTAGCGGCCGACTTCTCGATCGAGCAGTTCTGCCACCTGGTCAAGCTGCTC
GTGTGGCACGGGCGCAACAGCTACAAGCGGAGCGCGAAGCTGGCGCAGTTCGTCATCCACCGCGGCCTCATCATC
GCCGTCTGCCAGACCATGTACAGCATCGCGCTGAAATTCGAACCGGAAGGACTCTACAAGGACTGGCTTCTCGTC
GGCTACGCCACCGTCTACACGGCGGCCCCCGTCTTGTCCCTCGTTCTTGACAAGGACGTGGACGAGAACGTGGCC
AGCCTGTACCCAGAGCTGTACAAGGAGCTGACGTCCGGGCGGTCGTTGTCGTACCGCACCTTCTTCGTCTGGGTC
TTCGTATCCATCTACCAGGGCGGCATGATCCAGGGACTGTCGCAGATCCTGACCGAGGTGGACGGCAAGAAGATG
GTGGCCGTGAGCTACACGGTGCTCGTCCTCAACGAGCTCATCATGGTGGCCATCGAGATCACGACGTGGCATCCC
GTCATGATCATCAGCATCCTCGGCACCTTTCTCTTCTTTGTCGGGTCGATGCCCTTCCTCGGCGGCTACTTTGAC
CTCGAATTCCTCATTACGTGGGGCTTCGTGTGGCGCATCCTTGCCATCGGGGCCATCTCGCTCGTGCCTCCCTAC
GCCGGGAAGCTGATCCGGAGAGCCATCAGGCCTCCGTCGTACAGAAAGGTGCAGGACAGGTAG
Gene >Hirsu2|1419
ATGCCTCCTTCACCTCCGTACCGACCGACCGAGCCGCCCGATTCGCCCACGCATGACTCCGACTCCGATCTCGAC
CTTGACTTCGACGAGCTCGACCCCAATCCGGCCGAGCCGCCGCCATCCGGACCCGGCCGCCGCCAGCCGACGGCC
GAGCAGAGCACCTCGAGGATAGCACTGCGAAACTTGCGTATGGGAGGACTGCGCCGCGCCAACAAGCGTGGACGC
GAGTACGGGGAGCTCGGCGCCCGTCGCGACGACTCGGACGACCATGACGGACTCGCACAGTCCTGGTCCGACGGC
GGCGGAGGCCCCGGCGGCGACGACGATGTCCCGCTCCTGGGCGGCGATCCGCGCTCTCACCGCCGTCGCGAGTCC
CGCGGCAGCCTTCGACTGCCCAGCTTCATGTCCAAGAAGGCTGACGACGCCGGCTCTATCGAGAAGTCCGACGAC
GACCCCTCGTCGTCGAGGCTCGTCGCCGTCGGTTGCGCCCAGGCCACGCGCTTCCCCGCCAACATCGTCTCCAAC
GCCAAGTACACGGCTCTGACCTTCTTGCCCGTCACCCTGTACAATGAGTTCTCCTTTTTCTTCAACATGTACTTC
CTGCTCGTTGCTTTGTCGCAGGCGATACCCGCTCTGCGAATAGGCTACCTTTCGACCTATGTCGCCCCTCTGGCC
TTTGTCCTGCTCATCACCATGGGCAAGGAGGCCTACGACGACATCGAGAGGCGCCGCCGGGACACGGAGGCCAAC
TCGGAGGAGTACAGTGTGCTCGTATTCGGCGACCCCGACCTGCGTCCTGCTACGCTTCGGCCGCGTCGACCTCTG
AAATCCGACTCGGTCAGGCGTGGATCTCGAAGATCGAGGGGCGGGAGACACGACCTCTCCGACATCCAGGAGGAA
GAGGAGCAGGATGGAGCGGGAGCGCCTCAGCCGTCTTCTCATGTGATGGAAGTCAGCCGCAAATCGAAAGACCTC
AAAGTCGGCGACGTCCTGAAGCTGAGCAAGGGACAGCGGGTACCTGCGGATGTCGTCATCTTGCAGTGCTACATA
ACGGACGGTGCTGCCACCACTCCGGCCAAGGAACCGGCAGAAGAGGAGGCTTTGCTGGCCTTGGCCGACAGCGAG
CAGAACCAGAAGGGAAAGCAGCCCGTGGCCGAAGTGCTCAAAGACGAGGCAGAAACCGGCGCCGTCGGGGAGACG
TTCATCAGGACGGACCAGCTTGATGGCGAGACGGACTGGAAGCTGAGATTGGCCTCTCCCCTGACACAGAACCTG
CCGCCTGAAGAGTTTGTCCGCCTTCTCGTGACGGGCGGCAAGCCCGACAAGAAGGTCAATGAGTTTGTAGGGACT
GTCGAGCTGCGTCCCACGCGGCAGGATGCCCAGAGCCAACACGCCGTGCTCCAGCAGGAGGAAGATGTCTCCAAG
TCGTTCGCGCTGTCGATCGACAACACGGCATGGGCCAACACGGTCATCGCTTCGCAAGGCACAACCTTGGCCGTC
ATCATGTACGCGGGCCCGCAGACGCGGTCCGCCTTGTCGACTGCGCCCTCGCGTTCCAAGACCGGACTGCTGGAA
TACGAGATCAACTCCTTGACGAAAATCCTATGCGCGCTGACGCTGGCGCTGTCTATCGTGCTCGTCGCTCTCCAG
GGCTTCGAGAAGTCCGGGGGCAACATCTGGTACATTAAAATTATGCGCTTCCTCGTCCTTTTCTCGACCATTGTG
CCCATCAGCCTGCGCGTCAACCTGGACATGGGCAAGAGCGCGTATTCACGGTTCATCCAGCGCGACCCCGGCATT
CCGGGGGCTGTTGTCCGGACGAGCACCATCCCGGAAGATCTGGGGCGCATCGAGTACCTGCTCAGCGACAAGACG
GGAACTCTGACCCAGAATGACATGGAGATGAAGAAGATTCATGTAGGCACGGTCTCGTATGCCAACGAGGCGATG
GACGAGGTCGCCGTCTACGTCAAGCAAGGATTCCATATCCAACCCACCACCGAGCCGTCGTCCCGGACGATGCTC
ATCACCCCCTCGTCGACATATTCTGCTGCCGTCAATGTCGGCGCAACGCGCACGAGGAGGGAAATCGGATCGCGA
GTCCGTGATCTCGTCCTGGCTTTGGCGCTCTGCCATAACGTGACGCCCACGGTCGACACCGAAGATGGTCGAGAA
GTGATGTCGTACCAGGCATCGTCCCCAGACGAGATTGCAATAGTCAAGTGGACCGAGTCTGTTGGCCTGCGGCTA
TCGTACCGCGACCGCCAGAACATGACTCTGGAGTTTACAGAGAGCCGCCGGCCGATTGTGCGGGTCCGCATCCTC
GACGTCTTCCCTTTCACGTCGGACGGCAAGCGGATGGGCATCATTGTGCATTTCCAAGATGACCTCAGGGCGCCA
AAGTCCGACCTCAAGAGCGGCGAGATCTGGTTCTACCAGAAAGGCGCCGACACGGTCATGACCTCCATCGTCGCG
GCCAACGACTGGCTGGACGAGGAGACGGCCAACATGGCACGAGAGGGGTTGCGGACGCTCGTCGTGGGCCGCAAG
AAGCTATCCGTCCAGCAGTACCTAGAGTTCTCGTCCAGTCATCAGGAGGCCTCGCTGGCCATCGCCGGGCGCGAC
GCCGGGCTCCAGAGAGTGGTCTCGCGCCACCTCGAGAGCGACCTGGAGCTCCTGGGCGTGACGGGCGTGGAAGAC
AAGCTGCAGAAGGACGTCAAGCCGTCGCTGGAGCTCCTGCGCAACGCCGGCATCAAGATCTGGATGCTGACGGGC
GACAAGGTCGAGACGGCACGGTGCGTCGCGGTCAGCTCGAAGCTCGTCGCTAGAGGGCAGTACATCTACACCGTC
GCCAAGCTCAAGAAGAAGGACTACGCACGCGACCACCTCGACTTCCTGCGCAGCAAGACCGACGCCTGCCTGCTG
ATCGACGGCGAGAGCCTGGCCCTCCTGCTGACGCACTTCCGCATGGAGTTCATCACCGTCGCCGTCCAGCTGCCG
ACGGTGGTCGCCTGCCGCTGCTCTCCGACGCAGAAGGCCGAGGTGGCCAAGCTCATCAGGGAGTACACGAAGAAG
CGCGTGTGCTGCATAGGCGACGGCGGCAACGACGTGTCCATGATCCAGGCCGCGGACGTGGGCGTCGGCATCGTG
GGAAAGGAGGGGCGGCAGGCCAGCCTAGCGGCCGACTTCTCGATCGAGCAGTTCTGCCACCTGGTCAAGCTGCTC
GTGTGGCACGGGCGCAACAGCTACAAGCGGAGCGCGAAGCTGGCGCAGTTCGTCATCCACCGCGGCCTCATCATC
GCCGTCTGCCAGACCATGTACAGCATCGCGCTGAAATTCGAACCGGAAGGACTCTACAAGGCAAGCCAAAAGCCC
CTCCCTCTCCCAAATCTTACCCATTTCGCAACTCTGCTAACCCGAAGAGTGTTCCAGGACTGGCTTCTCGTCGGC
TACGCCACCGTCTACACGGCGGCCCCCGTCTTGTCCCTCGTTCTTGACAAGGACGTGGACGAGAACGTGGCCAGC
CTGTACCCAGAGCTGTACAAGGAGCTGACGTCCGGGCGGTCGTTGTCGTACCGCACCTTCTTCGTCTGGGTCTTC
GTATCCATCTACCAGGGCGGCATGATCCAGGGACTGTCGCAGATCCTGACCGAGGTGGACGGCAAGAAGATGGTG
GCCGTGAGCTACACGGTGCTCGTCCTCAACGAGCTCATCATGGTGGCCATCGAGATCACGACGTGGCATCCCGTC
ATGATCATCAGCATCCTCGGCACCTTTCTCTTCTTTGTCGGGTCGATGCCCTTCCTCGGCGGCTACTTTGACCTC
GAATTCCTCATTACGTGGTGAGTTTTGCCCCCCGGGTGCTCCGTGGCCCGCCGCCGCCGCCTCCTCTTTGCGGAC
CTCGTTCCTCCTCTTCTGACACGCCTCGTCCGTCCAGGGGCTTCGTGTGGCGCATCCTTGCCATCGGGGCCATCT
CGCTCGTGCCTCCCTACGCCGGGAAGCTGATCCGGAGAGCCATCAGGCCTCCGTCGTACAGAAAGGTGCAGGACA
GGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail