Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1417
Gene name
LocationContig_1309:6503..7376
Strand-
Gene length (bp)873
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00024 PAN_1 PAN domain 1.0E-04 180 238

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.4504 0.1567 0.8883 0.2267 0.2549 0.0549 0.1455 0.1719 0.3051 0.0071

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4906
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|69
Ophiocordyceps kimflemingae Ophio5|4627
Ophiocordyceps subramaniannii Hirsu2|1417 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4462
Ophiocordyceps subramaniannii Hirsu2|5169
Ophiocordyceps subramaniannii Hirsu2|5170

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1417
MYGNGGFSTTKAERVHHAFVTLPPAKEAPLTQSRMCSTECPSAHGQLFVGVTGENYLMSCHHRHGTKYLRDDRRD
SFEACMTACAVMPECRSVDYEPRTKRCLYSTHADHPAIAAQAFLSAHSLGCAGACAGCKKGCDAVGKEPLPADAA
RCDKDDGQLMVAGGEQMRLRCNHCWHSANDSIRSLRDVKSLAECARRCGEDPYCHGANWMGAASGCHFHPQLDKD
GKAPSMKRSAACDSVTPLLRSLAEYKEEDIQDSGITQRDW*
Coding >Hirsu2|1417
ATGTACGGCAACGGCGGCTTCTCGACGACCAAGGCGGAACGAGTCCATCACGCCTTCGTGACGCTCCCCCCGGCC
AAGGAGGCGCCCCTGACGCAGTCGCGGATGTGCTCGACCGAGTGCCCGTCTGCGCACGGCCAGCTCTTCGTGGGC
GTGACCGGCGAGAACTACCTCATGTCGTGCCACCACCGCCACGGCACCAAGTACCTCCGGGACGACCGGCGCGAC
TCGTTCGAGGCCTGCATGACGGCGTGCGCGGTGATGCCCGAGTGCCGCAGCGTCGACTACGAGCCGCGCACGAAG
CGCTGCCTGTACAGCACGCACGCGGACCACCCGGCCATCGCGGCGCAGGCCTTCCTGAGCGCGCACTCGCTCGGC
TGCGCCGGCGCCTGCGCCGGCTGCAAGAAGGGCTGCGACGCGGTCGGCAAGGAGCCGCTGCCGGCGGACGCGGCG
CGCTGCGACAAGGACGACGGCCAGCTGATGGTCGCGGGCGGCGAGCAGATGCGGCTGCGCTGCAACCACTGCTGG
CACAGCGCCAACGACTCGATCCGCTCCCTCCGCGACGTCAAGAGCCTGGCCGAGTGCGCCCGCCGCTGCGGCGAG
GACCCCTACTGCCACGGCGCCAACTGGATGGGCGCCGCCAGCGGCTGCCACTTCCACCCGCAGCTGGACAAGGAC
GGCAAGGCGCCGTCCATGAAGAGGAGCGCTGCCTGCGATTCCGTCACGCCCCTGCTCCGGAGCCTGGCCGAGTAC
AAGGAGGAGGACATCCAGGACTCCGGCATCACGCAGAGGGACTGGTAG
Transcript >Hirsu2|1417
ATGTACGGCAACGGCGGCTTCTCGACGACCAAGGCGGAACGAGTCCATCACGCCTTCGTGACGCTCCCCCCGGCC
AAGGAGGCGCCCCTGACGCAGTCGCGGATGTGCTCGACCGAGTGCCCGTCTGCGCACGGCCAGCTCTTCGTGGGC
GTGACCGGCGAGAACTACCTCATGTCGTGCCACCACCGCCACGGCACCAAGTACCTCCGGGACGACCGGCGCGAC
TCGTTCGAGGCCTGCATGACGGCGTGCGCGGTGATGCCCGAGTGCCGCAGCGTCGACTACGAGCCGCGCACGAAG
CGCTGCCTGTACAGCACGCACGCGGACCACCCGGCCATCGCGGCGCAGGCCTTCCTGAGCGCGCACTCGCTCGGC
TGCGCCGGCGCCTGCGCCGGCTGCAAGAAGGGCTGCGACGCGGTCGGCAAGGAGCCGCTGCCGGCGGACGCGGCG
CGCTGCGACAAGGACGACGGCCAGCTGATGGTCGCGGGCGGCGAGCAGATGCGGCTGCGCTGCAACCACTGCTGG
CACAGCGCCAACGACTCGATCCGCTCCCTCCGCGACGTCAAGAGCCTGGCCGAGTGCGCCCGCCGCTGCGGCGAG
GACCCCTACTGCCACGGCGCCAACTGGATGGGCGCCGCCAGCGGCTGCCACTTCCACCCGCAGCTGGACAAGGAC
GGCAAGGCGCCGTCCATGAAGAGGAGCGCTGCCTGCGATTCCGTCACGCCCCTGCTCCGGAGCCTGGCCGAGTAC
AAGGAGGAGGACATCCAGGACTCCGGCATCACGCAGAGGGACTGGTAG
Gene >Hirsu2|1417
ATGTACGGCAACGGCGGCTTCTCGACGACCAAGGCGGAACGAGTCCATCACGCCTTCGTGACGCTCCCCCCGGCC
AAGGAGGCGCCCCTGACGCAGTCGCGGATGTGCTCGACCGAGTGCCCGTCTGCGCACGGCCAGCTCTTCGTGGGC
GTGACCGGCGAGGTCAGTGATCCAGCTTGAACGGTATAACCAAACCCGTGCCTGGCCGGGACTGACACCTTGACG
TCGGCACGCCAGAACTACCTCATGTCGTGCCACCACCGCCACGGCACCAAGTACCTCCGGGACGACCGGCGCGAC
TCGTTCGAGGCCTGCATGACGGCGTGCGCGGTGATGCCCGAGTGCCGCAGCGTCGACTACGAGCCGCGCACGAAG
CGCTGCCTGTACAGCACGCACGCGGACCACCCGGCCATCGCGGCGCAGGCCTTCCTGAGCGCGCACTCGCTCGGC
TGCGCCGGCGCCTGCGCCGGCTGCAAGAAGGGCTGCGACGCGGTCGGCAAGGAGCCGCTGCCGGCGGACGCGGCG
CGCTGCGACAAGGACGACGGCCAGCTGATGGTCGCGGGCGGCGAGCAGATGCGGCTGCGCTGCAACCACTGCTGG
CACAGCGCCAACGACTCGATCCGCTCCCTCCGCGACGTCAAGAGCCTGGCCGAGTGCGCCCGCCGCTGCGGCGAG
GACCCCTACTGCCACGGCGCCAACTGGATGGGCGCCGCCAGCGGCTGCCACTTCCACCCGCAGCTGGACAAGGAC
GGCAAGGCGCCGTCCATGAAGAGGAGCGCTGCCTGCGATTCCGTCACGCCCCTGCTCCGGAGCCTGGCCGAGTAC
AAGGAGGAGGACATCCAGGACTCCGGCATCACGCAGAGGGACTGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail