Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1413
Gene name
LocationContig_1308:3035..4397
Strand-
Gene length (bp)1362
Transcript length (bp)1197
Coding sequence length (bp)1197
Protein length (aa) 399

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain 3.2E-65 254 392
PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain 5.4E-45 132 252
PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain 3.7E-42 20 117

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48466|METK_NEUCR S-adenosylmethionine synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eth-1 PE=2 SV=1 3 398 0.0E+00
sp|O60198|METK_SCHPO S-adenosylmethionine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sam1 PE=3 SV=1 19 398 0.0E+00
sp|P50304|METK_ASCIM S-adenosylmethionine synthase OS=Ascobolus immersus PE=3 SV=1 12 398 0.0E+00
sp|P19358|METK2_YEAST S-adenosylmethionine synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM2 PE=1 SV=3 15 398 0.0E+00
sp|P10659|METK1_YEAST S-adenosylmethionine synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM1 PE=1 SV=2 18 398 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48466|METK_NEUCR S-adenosylmethionine synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eth-1 PE=2 SV=1 3 398 0.0E+00
sp|O60198|METK_SCHPO S-adenosylmethionine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sam1 PE=3 SV=1 19 398 0.0E+00
sp|P50304|METK_ASCIM S-adenosylmethionine synthase OS=Ascobolus immersus PE=3 SV=1 12 398 0.0E+00
sp|P19358|METK2_YEAST S-adenosylmethionine synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM2 PE=1 SV=3 15 398 0.0E+00
sp|P10659|METK1_YEAST S-adenosylmethionine synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM1 PE=1 SV=2 18 398 0.0E+00
sp|Q5R5H1|METK2_PONAB S-adenosylmethionine synthase isoform type-2 OS=Pongo abelii GN=MAT2A PE=2 SV=1 4 398 0.0E+00
sp|Q4R924|METK2_MACFA S-adenosylmethionine synthase isoform type-2 OS=Macaca fascicularis GN=MAT2A PE=2 SV=1 4 398 0.0E+00
sp|P31153|METK2_HUMAN S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens GN=MAT2A PE=1 SV=1 4 398 0.0E+00
sp|P18298|METK2_RAT S-adenosylmethionine synthase isoform type-2 OS=Rattus norvegicus GN=Mat2a PE=1 SV=1 4 398 0.0E+00
sp|Q3THS6|METK2_MOUSE S-adenosylmethionine synthase isoform type-2 OS=Mus musculus GN=Mat2a PE=1 SV=2 4 398 0.0E+00
sp|Q00266|METK1_HUMAN S-adenosylmethionine synthase isoform type-1 OS=Homo sapiens GN=MAT1A PE=1 SV=2 4 398 0.0E+00
sp|Q2KJC6|METK1_BOVIN S-adenosylmethionine synthase isoform type-1 OS=Bos taurus GN=MAT1A PE=2 SV=1 15 398 0.0E+00
sp|P13444|METK1_RAT S-adenosylmethionine synthase isoform type-1 OS=Rattus norvegicus GN=Mat1a PE=1 SV=2 15 398 0.0E+00
sp|Q91X83|METK1_MOUSE S-adenosylmethionine synthase isoform type-1 OS=Mus musculus GN=Mat1a PE=1 SV=1 15 398 0.0E+00
sp|P50306|METK4_CAEEL Probable S-adenosylmethionine synthase 4 OS=Caenorhabditis elegans GN=sams-4 PE=1 SV=1 16 398 0.0E+00
sp|P50305|METK3_CAEEL Probable S-adenosylmethionine synthase 3 OS=Caenorhabditis elegans GN=sams-3 PE=1 SV=1 20 398 0.0E+00
sp|Q27522|METK5_CAEEL Probable S-adenosylmethionine synthase 5 OS=Caenorhabditis elegans GN=sams-5 PE=3 SV=2 20 398 2.0E-179
sp|Q54F07|METK_DICDI S-adenosylmethionine synthase OS=Dictyostelium discoideum GN=metK PE=1 SV=1 19 398 7.0E-179
sp|Q6SYB9|METK2_TOBAC S-adenosylmethionine synthase 2 OS=Nicotiana tabacum GN=SAMS2 PE=2 SV=1 19 397 3.0E-178
sp|P40320|METK_DROME S-adenosylmethionine synthase OS=Drosophila melanogaster GN=Sam-S PE=2 SV=2 4 398 3.0E-175
sp|Q95032|METK_ACACA S-adenosylmethionine synthase OS=Acanthamoeba castellanii GN=metK PE=2 SV=1 19 398 6.0E-175
sp|O17680|METK1_CAEEL Probable S-adenosylmethionine synthase 1 OS=Caenorhabditis elegans GN=sams-1 PE=1 SV=1 20 398 6.0E-174
sp|Q96552|METK2_CATRO S-adenosylmethionine synthase 2 OS=Catharanthus roseus GN=SAMS2 PE=1 SV=1 19 398 3.0E-167
sp|Q9LGU6|METK3_ORYSJ S-adenosylmethionine synthase 3 OS=Oryza sativa subsp. japonica GN=METK3 PE=2 SV=1 19 398 2.0E-166
sp|Q4LB21|METK4_HORVU S-adenosylmethionine synthase 4 OS=Hordeum vulgare GN=SAM4 PE=2 SV=1 19 398 3.0E-166
sp|B0LXM0|METK_WHEAT S-adenosylmethionine synthase OS=Triticum aestivum GN=SAMS PE=2 SV=1 19 398 3.0E-166
sp|A7PQS0|METK1_VITVI S-adenosylmethionine synthase 1 OS=Vitis vinifera GN=METK1 PE=3 SV=1 19 397 1.0E-165
sp|P93438|METK2_ORYSJ S-adenosylmethionine synthase 2 OS=Oryza sativa subsp. japonica GN=SAM2 PE=2 SV=1 19 398 4.0E-165
sp|Q0DKY4|METK1_ORYSJ S-adenosylmethionine synthase 1 OS=Oryza sativa subsp. japonica GN=SAM1 PE=2 SV=1 19 398 6.0E-165
sp|A2Y053|METK1_ORYSI S-adenosylmethionine synthase 1 OS=Oryza sativa subsp. indica GN=SAM1 PE=2 SV=2 19 398 6.0E-165
sp|A9PHC5|METK4_POPTR S-adenosylmethionine synthase 4 OS=Populus trichocarpa GN=METK4 PE=2 SV=1 19 397 6.0E-165
sp|P43282|METK3_SOLLC S-adenosylmethionine synthase 3 OS=Solanum lycopersicum GN=SAM3 PE=2 SV=1 19 397 9.0E-165
sp|Q4LB23|METK2_HORVU S-adenosylmethionine synthase 2 OS=Hordeum vulgare GN=SAM2 PE=2 SV=1 19 398 1.0E-164
sp|A7L2Z6|METK_GOSHI S-adenosylmethionine synthase OS=Gossypium hirsutum GN=SAMS PE=2 SV=1 19 398 1.0E-164
sp|P93254|METK_MESCR S-adenosylmethionine synthase OS=Mesembryanthemum crystallinum GN=METK PE=2 SV=1 19 398 2.0E-164
sp|O22338|METK_MUSAC S-adenosylmethionine synthase OS=Musa acuminata GN=METK PE=2 SV=1 19 398 2.0E-164
sp|A9P822|METK1_POPTR S-adenosylmethionine synthase 1 OS=Populus trichocarpa GN=METK1 PE=2 SV=1 19 398 2.0E-164
sp|A7QJG1|METK3_VITVI S-adenosylmethionine synthase 3 OS=Vitis vinifera GN=METK3 PE=3 SV=1 19 397 3.0E-164
sp|Q9FPL6|METK2_SUASA S-adenosylmethionine synthase 2 OS=Suaeda salsa GN=METK2 PE=2 SV=1 19 398 3.0E-164
sp|A9PEK8|METK3_POPTR S-adenosylmethionine synthase 3 OS=Populus trichocarpa GN=METK3 PE=2 SV=1 19 398 3.0E-164
sp|A9NUH8|METK1_PICSI S-adenosylmethionine synthase 1 OS=Picea sitchensis GN=METK1 PE=2 SV=1 19 398 3.0E-164
sp|P50302|METK2_ACTCH S-adenosylmethionine synthase 2 OS=Actinidia chinensis GN=SAM2 PE=2 SV=1 19 397 3.0E-164
sp|Q9AT55|METK2_ELAUM S-adenosylmethionine synthase 2 OS=Elaeagnus umbellata GN=SAMS2 PE=2 SV=1 19 398 4.0E-164
sp|P50299|METK1_HORVU S-adenosylmethionine synthase 1 OS=Hordeum vulgare GN=SAM1 PE=2 SV=1 19 398 4.0E-164
sp|Q96553|METK3_CATRO S-adenosylmethionine synthase 3 OS=Catharanthus roseus GN=SAMS3 PE=1 SV=1 19 397 4.0E-164
sp|Q6F3F0|METK3_ATRNU S-adenosylmethionine synthase 3 OS=Atriplex nummularia GN=SAMS3 PE=1 SV=1 19 398 5.0E-164
sp|A9PDZ7|METK2_POPTR S-adenosylmethionine synthase 2 OS=Populus trichocarpa GN=METK2 PE=2 SV=2 19 397 6.0E-164
sp|Q7XZR1|METK1_ATRNU S-adenosylmethionine synthase 1 OS=Atriplex nummularia GN=SAMS1 PE=1 SV=2 19 398 7.0E-164
sp|Q6F3F1|METK4_ATRNU S-adenosylmethionine synthase 4 OS=Atriplex nummularia GN=SAMS4 PE=1 SV=1 19 398 7.0E-164
sp|P50301|METK1_ACTCH S-adenosylmethionine synthase 1 OS=Actinidia chinensis GN=SAM1 PE=2 SV=1 19 397 8.0E-164
sp|Q9AT56|METK1_ELAUM S-adenosylmethionine synthase 1 OS=Elaeagnus umbellata GN=SAMS1 PE=2 SV=1 19 398 9.0E-164
sp|Q944U4|METK_DENCR S-adenosylmethionine synthase OS=Dendrobium crumenatum GN=SAMS PE=2 SV=1 19 398 9.0E-164
sp|A6XMY9|METK1_TRIMO S-adenosylmethionine synthase 1 OS=Triticum monococcum GN=SAMS1 PE=2 SV=1 19 398 1.0E-163
sp|Q9M7K8|METK1_TOBAC S-adenosylmethionine synthase 1 OS=Nicotiana tabacum GN=SAMS1 PE=2 SV=1 19 397 2.0E-163
sp|Q8GTL5|METK_CARPA S-adenosylmethionine synthase OS=Carica papaya GN=SAMS PE=2 SV=1 19 395 2.0E-163
sp|Q6F3F3|METK2_ATRNU S-adenosylmethionine synthase 2 OS=Atriplex nummularia GN=SAMS2 PE=1 SV=1 19 398 3.0E-163
sp|P47916|METK_POPDE S-adenosylmethionine synthase OS=Populus deltoides GN=METK PE=2 SV=1 19 398 4.0E-163
sp|Q38JH8|METK2_SOLTU S-adenosylmethionine synthase 2 OS=Solanum tuberosum GN=METK2 PE=2 SV=1 19 397 4.0E-163
sp|A7NVX9|METK2_VITVI S-adenosylmethionine synthase 2 OS=Vitis vinifera GN=METK2 PE=3 SV=1 19 398 5.0E-163
sp|Q96551|METK1_CATRO S-adenosylmethionine synthase 1 OS=Catharanthus roseus GN=SAMS1 PE=1 SV=1 19 398 6.0E-163
sp|Q4H1G3|METK2_BETVU S-adenosylmethionine synthase 2 OS=Beta vulgaris GN=SAMS2 PE=2 SV=1 19 398 6.0E-163
sp|Q9SBQ7|METK3_PETHY S-adenosylmethionine synthase 3 OS=Petunia hybrida GN=SAM3 PE=2 SV=1 19 397 7.0E-163
sp|Q307Y9|METK1_SOLTU S-adenosylmethionine synthase 1 OS=Solanum tuberosum GN=METK1 PE=2 SV=1 19 398 7.0E-163
sp|A7PRJ6|METK4_VITVI S-adenosylmethionine synthase 4 OS=Vitis vinifera GN=METK4 PE=3 SV=1 19 397 7.0E-163
sp|A9PHE9|METK5_POPTR S-adenosylmethionine synthase 5 OS=Populus trichocarpa GN=METK5 PE=2 SV=1 19 398 8.0E-163
sp|Q4H1G4|METK1_BETVU S-adenosylmethionine synthase 1 OS=Beta vulgaris GN=SAMS1 PE=2 SV=1 14 398 1.0E-162
sp|Q8W3Y4|METK_PHALU S-adenosylmethionine synthase OS=Phaseolus lunatus GN=SAMS PE=2 SV=1 19 398 1.0E-162
sp|A4PU48|METK_MEDTR S-adenosylmethionine synthase OS=Medicago truncatula GN=METK PE=3 SV=1 19 398 1.0E-162
sp|P43281|METK2_SOLLC S-adenosylmethionine synthase 2 OS=Solanum lycopersicum GN=SAM2 PE=2 SV=1 19 398 2.0E-162
sp|A7Q0V4|METK5_VITVI S-adenosylmethionine synthase 5 OS=Vitis vinifera GN=METK5 PE=3 SV=1 19 398 2.0E-162
sp|Q5DNB1|METK_BRARP S-adenosylmethionine synthase OS=Brassica rapa subsp. pekinensis GN=SAMS PE=2 SV=1 19 398 2.0E-162
sp|Q94FA4|METK5_BRAJU S-adenosylmethionine synthase 5 OS=Brassica juncea GN=MSAMS5 PE=2 SV=1 19 398 2.0E-162
sp|Q9SJL8|METK3_ARATH S-adenosylmethionine synthase 3 OS=Arabidopsis thaliana GN=METK3 PE=1 SV=1 19 397 3.0E-162
sp|P49611|METK1_BRAJU S-adenosylmethionine synthase 1 OS=Brassica juncea GN=SAMS1 PE=2 SV=1 19 398 3.0E-162
sp|Q9SBQ5|METK2_PETHY S-adenosylmethionine synthase 2 OS=Petunia hybrida GN=SAM2 PE=2 SV=1 19 397 5.0E-162
sp|Q4LB22|METK3_HORVU S-adenosylmethionine synthase 3 OS=Hordeum vulgare GN=SAM3 PE=2 SV=1 19 398 5.0E-162
sp|P43280|METK1_SOLLC S-adenosylmethionine synthase 1 OS=Solanum lycopersicum GN=SAM1 PE=2 SV=1 19 398 7.0E-162
sp|Q84MM2|METK_LITCN S-adenosylmethionine synthase OS=Litchi chinensis GN=SAMS PE=2 SV=1 19 398 9.0E-162
sp|A8HYU5|METK_CHLRE S-adenosylmethionine synthase OS=Chlamydomonas reinhardtii GN=METM PE=3 SV=1 19 397 9.0E-162
sp|P17562|METK2_ARATH S-adenosylmethionine synthase 2 OS=Arabidopsis thaliana GN=SAM2 PE=1 SV=1 19 398 1.0E-161
sp|P23686|METK1_ARATH S-adenosylmethionine synthase 1 OS=Arabidopsis thaliana GN=SAM1 PE=1 SV=2 19 398 1.0E-161
sp|Q9LUT2|METK4_ARATH S-adenosylmethionine synthase 4 OS=Arabidopsis thaliana GN=METK4 PE=1 SV=1 19 397 1.0E-161
sp|A4ULF8|METK_MEDSF S-adenosylmethionine synthase OS=Medicago sativa subsp. falcata GN=SAMS PE=2 SV=1 19 397 1.0E-161
sp|P48498|METK1_PETHY S-adenosylmethionine synthase 1 OS=Petunia hybrida GN=SAM1 PE=2 SV=1 19 397 5.0E-161
sp|Q9FUZ1|METK2_BRAJU S-adenosylmethionine synthase 2 OS=Brassica juncea GN=MSAMS2 PE=2 SV=1 19 397 5.0E-161
sp|Q94FA5|METK4_BRAJU S-adenosylmethionine synthase 4 OS=Brassica juncea GN=MSAMS4 PE=2 SV=1 19 397 7.0E-161
sp|Q6GV10|METK_SOLPL S-adenosylmethionine synthase OS=Solanum palustre GN=SAMS PE=2 SV=1 19 398 1.0E-160
sp|Q94FA6|METK3_BRAJU S-adenosylmethionine synthase 3 OS=Brassica juncea GN=MSAMS3 PE=2 SV=1 19 398 1.0E-160
sp|A9NYY0|METK2_PICSI S-adenosylmethionine synthase 2 OS=Picea sitchensis GN=METK2 PE=2 SV=1 19 398 2.0E-160
sp|P24260|METK2_DIACA S-adenosylmethionine synthase 2 OS=Dianthus caryophyllus GN=SAM2 PE=2 SV=1 19 398 2.0E-159
sp|Q56TU3|METK2_DAUCA S-adenosylmethionine synthase 2 OS=Daucus carota GN=SAMS2 PE=2 SV=1 19 398 7.0E-159
sp|Q9LDQ7|METK_CAMSI S-adenosylmethionine synthase OS=Camellia sinensis GN=SAM PE=2 SV=1 19 395 3.0E-158
sp|Q9FVG7|METK2_PINCO S-adenosylmethionine synthase 2 OS=Pinus contorta GN=SAMS2 PE=2 SV=1 19 398 1.0E-157
sp|Q837P9|METK_ENTFA S-adenosylmethionine synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=metK PE=3 SV=1 21 397 1.0E-156
sp|Q56TU4|METK1_DAUCA S-adenosylmethionine synthase 1 OS=Daucus carota GN=SAMS1 PE=2 SV=1 19 386 4.0E-156
sp|P50300|METK_PINBN S-adenosylmethionine synthase OS=Pinus banksiana GN=METK PE=2 SV=1 19 398 4.0E-156
sp|A9P2P4|METK3_PICSI S-adenosylmethionine synthase 3 OS=Picea sitchensis GN=METK3 PE=2 SV=1 19 397 5.0E-156
sp|Q38YF8|METK_LACSS S-adenosylmethionine synthase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metK PE=3 SV=1 21 392 1.0E-155
sp|O43938|METK_LEIIN S-adenosylmethionine synthase OS=Leishmania infantum GN=METK PE=2 SV=2 19 396 2.0E-155
sp|Q00VB2|METK_OSTTA S-adenosylmethionine synthase OS=Ostreococcus tauri GN=METK PE=3 SV=1 20 392 1.0E-153
sp|P49613|METK2_PEA S-adenosylmethionine synthase 2 OS=Pisum sativum GN=SAMS2 PE=2 SV=1 19 370 1.0E-153
sp|Q5KW02|METK_GEOKA S-adenosylmethionine synthase OS=Geobacillus kaustophilus (strain HTA426) GN=metK PE=3 SV=1 21 392 2.0E-152
sp|Q3AFS4|METK_CARHZ S-adenosylmethionine synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metK PE=3 SV=1 21 392 5.0E-152
sp|A4S779|METK_OSTLU S-adenosylmethionine synthase OS=Ostreococcus lucimarinus (strain CCE9901) GN=METK-1 PE=3 SV=1 20 392 5.0E-152
sp|C5D6E9|METK_GEOSW S-adenosylmethionine synthase OS=Geobacillus sp. (strain WCH70) GN=metK PE=3 SV=1 21 392 1.0E-151
sp|A9KL72|METK_CLOPH S-adenosylmethionine synthase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=metK PE=3 SV=1 20 392 1.0E-151
sp|A4VWU8|METK_STRSY S-adenosylmethionine synthase OS=Streptococcus suis (strain 05ZYH33) GN=metK PE=3 SV=1 21 392 1.0E-150
sp|A4W351|METK_STRS2 S-adenosylmethionine synthase OS=Streptococcus suis (strain 98HAH33) GN=metK PE=3 SV=1 21 392 1.0E-150
sp|Q9CEE0|METK_LACLA S-adenosylmethionine synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metK PE=3 SV=1 21 392 2.0E-150
sp|A4IRZ1|METK_GEOTN S-adenosylmethionine synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=metK PE=3 SV=1 21 392 2.0E-150
sp|Q02WN8|METK_LACLS S-adenosylmethionine synthase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=metK PE=3 SV=1 21 392 2.0E-150
sp|A2RN40|METK_LACLM S-adenosylmethionine synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metK PE=3 SV=1 21 392 3.0E-150
sp|A8YWU7|METK_LACH4 S-adenosylmethionine synthase OS=Lactobacillus helveticus (strain DPC 4571) GN=metK PE=3 SV=1 21 392 3.0E-150
sp|Q816Q8|METK_BACCR S-adenosylmethionine synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metK PE=3 SV=1 21 392 4.0E-150
sp|B7H9C7|METK_BACC4 S-adenosylmethionine synthase OS=Bacillus cereus (strain B4264) GN=metK PE=3 SV=1 21 392 4.0E-150
sp|Q72YV6|METK_BACC1 S-adenosylmethionine synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metK PE=3 SV=1 21 392 6.0E-150
sp|Q8NVZ9|METK_STAAW S-adenosylmethionine synthase OS=Staphylococcus aureus (strain MW2) GN=metK PE=3 SV=1 21 392 7.0E-150
sp|A8Z4L2|METK_STAAT S-adenosylmethionine synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=metK PE=3 SV=1 21 392 7.0E-150
sp|Q6G8E3|METK_STAAS S-adenosylmethionine synthase OS=Staphylococcus aureus (strain MSSA476) GN=metK PE=3 SV=1 21 392 7.0E-150
sp|A6QHX0|METK_STAAE S-adenosylmethionine synthase OS=Staphylococcus aureus (strain Newman) GN=metK PE=3 SV=1 21 392 7.0E-150
sp|Q5HEY9|METK_STAAC S-adenosylmethionine synthase OS=Staphylococcus aureus (strain COL) GN=metK PE=3 SV=1 21 392 7.0E-150
sp|Q2YTK1|METK_STAAB S-adenosylmethionine synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metK PE=3 SV=2 21 392 7.0E-150
sp|Q2G1W4|METK_STAA8 S-adenosylmethionine synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=metK PE=3 SV=1 21 392 7.0E-150
sp|Q2FFV6|METK_STAA3 S-adenosylmethionine synthase OS=Staphylococcus aureus (strain USA300) GN=metK PE=3 SV=1 21 392 7.0E-150
sp|B7IL28|METK_BACC2 S-adenosylmethionine synthase OS=Bacillus cereus (strain G9842) GN=metK PE=3 SV=1 21 392 9.0E-150
sp|Q6GFR6|METK_STAAR S-adenosylmethionine synthase OS=Staphylococcus aureus (strain MRSA252) GN=metK PE=3 SV=1 21 392 9.0E-150
sp|P66767|METK_STAAN S-adenosylmethionine synthase OS=Staphylococcus aureus (strain N315) GN=metK PE=1 SV=1 21 392 1.0E-149
sp|P66766|METK_STAAM S-adenosylmethionine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metK PE=3 SV=1 21 392 1.0E-149
sp|A5ITV6|METK_STAA9 S-adenosylmethionine synthase OS=Staphylococcus aureus (strain JH9) GN=metK PE=3 SV=1 21 392 1.0E-149
sp|A6U2Q1|METK_STAA2 S-adenosylmethionine synthase OS=Staphylococcus aureus (strain JH1) GN=metK PE=3 SV=1 21 392 1.0E-149
sp|A7X3N2|METK_STAA1 S-adenosylmethionine synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=metK PE=3 SV=1 21 392 1.0E-149
sp|C1EW36|METK_BACC3 S-adenosylmethionine synthase OS=Bacillus cereus (strain 03BB102) GN=metK PE=3 SV=1 21 392 2.0E-149
sp|A0RJZ7|METK_BACAH S-adenosylmethionine synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=metK PE=3 SV=1 21 392 2.0E-149
sp|Q632S5|METK_BACCZ S-adenosylmethionine synthase OS=Bacillus cereus (strain ZK / E33L) GN=metK PE=3 SV=1 21 392 2.0E-149
sp|B9J265|METK_BACCQ S-adenosylmethionine synthase OS=Bacillus cereus (strain Q1) GN=metK PE=3 SV=1 21 392 2.0E-149
sp|B7JT32|METK_BACC0 S-adenosylmethionine synthase OS=Bacillus cereus (strain AH820) GN=metK PE=3 SV=1 21 392 2.0E-149
sp|Q81KI0|METK_BACAN S-adenosylmethionine synthase OS=Bacillus anthracis GN=metK PE=3 SV=1 21 392 2.0E-149
sp|C3LAZ9|METK_BACAC S-adenosylmethionine synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=metK PE=3 SV=1 21 392 2.0E-149
sp|C3PCC4|METK_BACAA S-adenosylmethionine synthase OS=Bacillus anthracis (strain A0248) GN=metK PE=3 SV=1 21 392 2.0E-149
sp|P50307|METK_STAAU S-adenosylmethionine synthase OS=Staphylococcus aureus GN=metK PE=3 SV=1 21 392 3.0E-149
sp|A9VLC6|METK_BACWK S-adenosylmethionine synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=metK PE=3 SV=1 21 392 4.0E-149
sp|A3CNY4|METK_STRSV S-adenosylmethionine synthase OS=Streptococcus sanguinis (strain SK36) GN=metK PE=3 SV=1 21 392 5.0E-149
sp|Q6HCB4|METK_BACHK S-adenosylmethionine synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metK PE=3 SV=1 21 392 5.0E-149
sp|B7HSV6|METK_BACC7 S-adenosylmethionine synthase OS=Bacillus cereus (strain AH187) GN=metK PE=3 SV=1 21 392 5.0E-149
sp|P61946|METK_GEOSL S-adenosylmethionine synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=metK PE=3 SV=1 20 392 6.0E-149
sp|Q9K7Q9|METK_BACHD S-adenosylmethionine synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=metK PE=3 SV=1 21 392 6.0E-149
sp|A8AWW6|METK_STRGC S-adenosylmethionine synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=metK PE=3 SV=1 21 392 6.0E-149
sp|B2G8G3|METK_LACRJ S-adenosylmethionine synthase OS=Lactobacillus reuteri (strain JCM 1112) GN=metK PE=3 SV=1 21 391 9.0E-149
sp|A5VL29|METK_LACRD S-adenosylmethionine synthase OS=Lactobacillus reuteri (strain DSM 20016) GN=metK PE=3 SV=1 21 391 9.0E-149
sp|Q8DT23|METK_STRMU S-adenosylmethionine synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=metK PE=3 SV=1 21 392 2.0E-148
sp|A3DHM4|METK_CLOTH S-adenosylmethionine synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=metK PE=3 SV=1 21 392 3.0E-148
sp|Q39W48|METK_GEOMG S-adenosylmethionine synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=metK PE=3 SV=1 20 392 3.0E-148
sp|B4RWC7|METK_ALTMD S-adenosylmethionine synthase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=metK PE=3 SV=1 19 397 4.0E-148
sp|A8FGH7|METK_BACP2 S-adenosylmethionine synthase OS=Bacillus pumilus (strain SAFR-032) GN=metK PE=3 SV=1 21 392 4.0E-148
sp|Q67T90|METK_SYMTH S-adenosylmethionine synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metK PE=3 SV=1 18 392 5.0E-148
sp|B8I4C1|METK_CLOCE S-adenosylmethionine synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=metK PE=3 SV=1 21 392 7.0E-148
sp|A7GU40|METK_BACCN S-adenosylmethionine synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=metK PE=3 SV=1 21 392 7.0E-148
sp|C0MCM1|METK_STRS7 S-adenosylmethionine synthase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=metK PE=3 SV=1 21 391 8.0E-148
sp|Q5M434|METK_STRT2 S-adenosylmethionine synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=metK PE=3 SV=2 21 392 1.0E-147
sp|C0M9M7|METK_STRE4 S-adenosylmethionine synthase OS=Streptococcus equi subsp. equi (strain 4047) GN=metK PE=3 SV=1 21 392 1.0E-147
sp|Q5LZI0|METK_STRT1 S-adenosylmethionine synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=metK PE=3 SV=2 21 392 2.0E-147
sp|Q5WDZ8|METK_BACSK S-adenosylmethionine synthase OS=Bacillus clausii (strain KSM-K16) GN=metK PE=3 SV=1 14 397 3.0E-147
sp|Q4L7C7|METK_STAHJ S-adenosylmethionine synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=metK PE=3 SV=1 21 392 3.0E-147
sp|Q65FV8|METK_BACLD S-adenosylmethionine synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metK PE=3 SV=1 21 392 3.0E-147
sp|A5GA66|METK_GEOUR S-adenosylmethionine synthase OS=Geobacter uraniireducens (strain Rf4) GN=metK PE=3 SV=1 20 392 3.0E-147
sp|B4U228|METK_STREM S-adenosylmethionine synthase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=metK PE=3 SV=1 21 391 3.0E-147
sp|Q8EP05|METK_OCEIH S-adenosylmethionine synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metK PE=3 SV=1 21 392 7.0E-147
sp|Q74KS4|METK_LACJO S-adenosylmethionine synthase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=metK PE=3 SV=1 21 397 9.0E-147
sp|B1LB17|METK_THESQ S-adenosylmethionine synthase OS=Thermotoga sp. (strain RQ2) GN=metK PE=3 SV=1 21 392 1.0E-146
sp|A5ILS4|METK_THEP1 S-adenosylmethionine synthase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=metK PE=3 SV=1 21 392 1.0E-146
sp|Q9X1Y8|METK_THEMA S-adenosylmethionine synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=metK PE=3 SV=1 21 392 1.0E-146
sp|B9DN19|METK_STACT S-adenosylmethionine synthase OS=Staphylococcus carnosus (strain TM300) GN=metK PE=3 SV=1 21 392 1.0E-146
sp|Q92AZ5|METK_LISIN S-adenosylmethionine synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metK PE=3 SV=1 21 397 3.0E-146
sp|C6E2L2|METK_GEOSM S-adenosylmethionine synthase OS=Geobacter sp. (strain M21) GN=metK PE=3 SV=1 20 392 3.0E-146
sp|Q5FIN8|METK_LACAC S-adenosylmethionine synthase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=metK PE=3 SV=1 21 392 4.0E-146
sp|B9DSM6|METK_STRU0 S-adenosylmethionine synthase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=metK PE=3 SV=1 21 392 5.0E-146
sp|Q88XB8|METK_LACPL S-adenosylmethionine synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metK PE=3 SV=1 21 397 8.0E-146
sp|B8DFQ7|METK_LISMH S-adenosylmethionine synthase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=metK PE=3 SV=1 21 397 8.0E-146
sp|Q71Z03|METK_LISMF S-adenosylmethionine synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metK PE=3 SV=1 21 397 8.0E-146
sp|C1KVW3|METK_LISMC S-adenosylmethionine synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=metK PE=3 SV=1 21 397 8.0E-146
sp|B3WCC9|METK_LACCB S-adenosylmethionine synthase OS=Lactobacillus casei (strain BL23) GN=metK PE=3 SV=1 21 391 9.0E-146
sp|Q03AU4|METK_LACC3 S-adenosylmethionine synthase OS=Lactobacillus casei (strain ATCC 334) GN=metK PE=3 SV=1 21 391 9.0E-146
sp|Q8DQH0|METK_STRR6 S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=metK PE=3 SV=1 21 392 1.0E-145
sp|B2INE5|METK_STRPS S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain CGSP14) GN=metK PE=3 SV=1 21 392 1.0E-145
sp|B1IAT8|METK_STRPI S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=metK PE=3 SV=1 21 392 1.0E-145
sp|B5E364|METK_STRP4 S-adenosylmethionine synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=metK PE=3 SV=1 21 392 1.0E-145
sp|Q04LE0|METK_STRP2 S-adenosylmethionine synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=metK PE=3 SV=1 21 392 1.0E-145
sp|Q3A388|METK_PELCD S-adenosylmethionine synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=metK PE=3 SV=1 16 392 2.0E-145
sp|Q15QK1|METK_PSEA6 S-adenosylmethionine synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=metK PE=3 SV=1 21 392 2.0E-145
sp|B9K7H2|METK_THENN S-adenosylmethionine synthase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=metK PE=3 SV=1 21 392 3.0E-145
sp|A0AJB9|METK_LISW6 S-adenosylmethionine synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=metK PE=3 SV=1 21 397 3.0E-145
sp|A1JPS4|METK_YERE8 S-adenosylmethionine synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=metK PE=3 SV=1 21 392 4.0E-145
sp|C1C6A5|METK_STRP7 S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain 70585) GN=metK PE=3 SV=1 21 392 4.0E-145
sp|Q8Y6M0|METK_LISMO S-adenosylmethionine synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metK PE=3 SV=1 21 397 4.0E-145
sp|B8ZNB7|METK_STRPJ S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=metK PE=3 SV=1 21 392 4.0E-145
sp|Q7N119|METK_PHOLL S-adenosylmethionine synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metK PE=3 SV=1 19 397 5.0E-145
sp|Q2NRD1|METK_SODGM S-adenosylmethionine synthase OS=Sodalis glossinidius (strain morsitans) GN=metK PE=3 SV=1 21 392 6.0E-145
sp|Q18CL7|METK_PEPD6 S-adenosylmethionine synthase OS=Peptoclostridium difficile (strain 630) GN=metK PE=3 SV=1 21 392 6.0E-145
sp|C1CJL0|METK_STRZP S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain P1031) GN=metK PE=3 SV=1 21 392 7.0E-145
sp|B2GDG2|METK_LACF3 S-adenosylmethionine synthase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=metK PE=3 SV=1 21 392 1.0E-144
sp|B5XM14|METK_STRPZ S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=metK PE=3 SV=1 21 392 1.0E-144
sp|A2RE06|METK_STRPG S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=metK PE=3 SV=1 21 392 1.0E-144
sp|Q1JL80|METK_STRPC S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=metK PE=3 SV=1 21 392 1.0E-144
sp|Q1JB36|METK_STRPB S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=metK PE=3 SV=1 21 392 1.0E-144
sp|Q8P0G6|METK_STRP8 S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=metK PE=3 SV=1 21 392 1.0E-144
sp|Q5XBJ6|METK_STRP6 S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=metK PE=3 SV=1 21 392 1.0E-144
sp|B0KC73|METK_THEP3 S-adenosylmethionine synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=metK PE=3 SV=1 21 392 1.0E-144
sp|Q1J626|METK_STRPF S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=metK PE=3 SV=1 21 392 2.0E-144
sp|C1CQM2|METK_STRZT S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=metK PE=3 SV=1 21 392 2.0E-144
sp|Q97RN9|METK_STRPN S-adenosylmethionine synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=metK PE=3 SV=1 21 392 2.0E-144
sp|B9MQ10|METK_CALBD S-adenosylmethionine synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=metK PE=3 SV=1 21 392 2.0E-144
sp|A7Z7Y9|METK_BACMF S-adenosylmethionine synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=metK PE=3 SV=1 21 392 2.0E-144
sp|P0DF55|METK_STRPQ S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=metK PE=3 SV=1 21 391 2.0E-144
sp|P0DF54|METK_STRP3 S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=metK PE=3 SV=1 21 391 2.0E-144
sp|Q99Z77|METK_STRP1 S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M1 GN=metK PE=3 SV=1 21 392 2.0E-144
sp|P54419|METK_BACSU S-adenosylmethionine synthase OS=Bacillus subtilis (strain 168) GN=metK PE=3 SV=2 21 392 3.0E-144
sp|Q48SU7|METK_STRPM S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=metK PE=3 SV=1 21 392 3.0E-144
sp|Q0SR05|METK_CLOPS S-adenosylmethionine synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=metK PE=3 SV=1 21 392 3.0E-144
sp|Q0TND4|METK_CLOP1 S-adenosylmethionine synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=metK PE=3 SV=1 21 392 3.0E-144
sp|Q6FAQ6|METK_ACIAD S-adenosylmethionine synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metK PE=3 SV=1 21 392 4.0E-144
sp|B2VF06|METK_ERWT9 S-adenosylmethionine synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=metK PE=3 SV=1 21 392 4.0E-144
sp|A5IDK5|METK_LEGPC S-adenosylmethionine synthase OS=Legionella pneumophila (strain Corby) GN=metK PE=3 SV=1 19 392 9.0E-144
sp|Q5X3N0|METK_LEGPA S-adenosylmethionine synthase OS=Legionella pneumophila (strain Paris) GN=metK PE=3 SV=1 19 392 9.0E-144
sp|Q5ZTY6|METK_LEGPH S-adenosylmethionine synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=metK PE=3 SV=1 19 392 1.0E-143
sp|Q03QA4|METK_LACBA S-adenosylmethionine synthase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=metK PE=3 SV=1 21 397 2.0E-143
sp|Q5WV18|METK_LEGPL S-adenosylmethionine synthase OS=Legionella pneumophila (strain Lens) GN=metK PE=3 SV=1 19 392 2.0E-143
sp|A4XHT8|METK_CALS8 S-adenosylmethionine synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=metK PE=3 SV=1 21 392 2.0E-143
sp|Q1QCH2|METK_PSYCK S-adenosylmethionine synthase OS=Psychrobacter cryohalolentis (strain K5) GN=metK PE=3 SV=1 21 398 2.0E-143
sp|A9MRD1|METK_SALAR S-adenosylmethionine synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=metK PE=3 SV=1 21 392 2.0E-143
sp|Q1LS34|METK_CUPMC S-adenosylmethionine synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=metK PE=3 SV=1 20 391 3.0E-143
sp|Q8CNT5|METK_STAES S-adenosylmethionine synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=metK PE=3 SV=1 21 392 3.0E-143
sp|Q5HNB8|METK_STAEQ S-adenosylmethionine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=metK PE=3 SV=1 21 392 3.0E-143
sp|Q8E5Y0|METK_STRA3 S-adenosylmethionine synthase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=metK PE=3 SV=1 21 397 3.0E-143
sp|Q49YL6|METK_STAS1 S-adenosylmethionine synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=metK PE=3 SV=1 21 392 3.0E-143
sp|A8GIX9|METK_SERP5 S-adenosylmethionine synthase OS=Serratia proteamaculans (strain 568) GN=metK PE=3 SV=1 21 391 3.0E-143
sp|Q486L6|METK_COLP3 S-adenosylmethionine synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=metK PE=3 SV=1 21 392 3.0E-143
sp|Q6AQ43|METK_DESPS S-adenosylmethionine synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=metK PE=3 SV=1 19 392 3.0E-143
sp|Q1JGA1|METK_STRPD S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=metK PE=3 SV=1 21 392 4.0E-143
sp|B5XUA8|METK_KLEP3 S-adenosylmethionine synthase OS=Klebsiella pneumoniae (strain 342) GN=metK PE=3 SV=1 21 392 5.0E-143
sp|A7NFR6|METK_ROSCS S-adenosylmethionine synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=metK PE=3 SV=1 20 392 5.0E-143
sp|Q6MPK2|METK_BDEBA S-adenosylmethionine synthase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=metK PE=3 SV=1 19 392 5.0E-143
sp|Q8E0A3|METK_STRA5 S-adenosylmethionine synthase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=metK PE=3 SV=1 21 397 6.0E-143
sp|Q3K1M7|METK_STRA1 S-adenosylmethionine synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=metK PE=3 SV=1 21 397 6.0E-143
sp|B4F1A5|METK_PROMH S-adenosylmethionine synthase OS=Proteus mirabilis (strain HI4320) GN=metK PE=3 SV=1 19 391 6.0E-143
sp|A4WE78|METK_ENT38 S-adenosylmethionine synthase OS=Enterobacter sp. (strain 638) GN=metK PE=3 SV=1 21 392 7.0E-143
sp|Q1H4X2|METK_METFK S-adenosylmethionine synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=metK PE=3 SV=1 20 391 8.0E-143
sp|Q3SFY2|METK_THIDA S-adenosylmethionine synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=metK PE=3 SV=1 20 391 9.0E-143
sp|Q31WK4|METK_SHIBS S-adenosylmethionine synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=metK PE=3 SV=1 21 392 1.0E-142
sp|B2U0W2|METK_SHIB3 S-adenosylmethionine synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=metK PE=3 SV=1 21 392 1.0E-142
sp|A7MJQ6|METK_CROS8 S-adenosylmethionine synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=metK PE=3 SV=1 21 392 1.0E-142
sp|B5RE50|METK_SALG2 S-adenosylmethionine synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=metK PE=3 SV=1 21 392 1.0E-142
sp|B9LBJ9|METK_CHLSY S-adenosylmethionine synthase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=metK PE=3 SV=1 20 392 1.0E-142
sp|A9WGQ3|METK_CHLAA S-adenosylmethionine synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=metK PE=3 SV=1 20 392 1.0E-142
sp|P66764|METK_SALTY S-adenosylmethionine synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metK PE=3 SV=2 21 392 2.0E-142
sp|P66765|METK_SALTI S-adenosylmethionine synthase OS=Salmonella typhi GN=metK PE=3 SV=2 21 392 2.0E-142
sp|B4TV58|METK_SALSV S-adenosylmethionine synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B5BFP7|METK_SALPK S-adenosylmethionine synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|Q5PJJ2|METK_SALPA S-adenosylmethionine synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B4T5J6|METK_SALNS S-adenosylmethionine synthase OS=Salmonella newport (strain SL254) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B5QY66|METK_SALEP S-adenosylmethionine synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|Q57K26|METK_SALCH S-adenosylmethionine synthase OS=Salmonella choleraesuis (strain SC-B67) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|Q2T267|METK_BURTA S-adenosylmethionine synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=metK PE=3 SV=1 20 391 2.0E-142
sp|B7LPQ9|METK_ESCF3 S-adenosylmethionine synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B5F5L4|METK_SALA4 S-adenosylmethionine synthase OS=Salmonella agona (strain SL483) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|Q3YXS9|METK_SHISS S-adenosylmethionine synthase OS=Shigella sonnei (strain Ss046) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|P0A820|METK_SHIFL S-adenosylmethionine synthase OS=Shigella flexneri GN=metK PE=3 SV=2 21 392 2.0E-142
sp|Q0T0V0|METK_SHIF8 S-adenosylmethionine synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|Q32C11|METK_SHIDS S-adenosylmethionine synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B1LDF1|METK_ECOSM S-adenosylmethionine synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B6I780|METK_ECOSE S-adenosylmethionine synthase OS=Escherichia coli (strain SE11) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B7N7J5|METK_ECOLU S-adenosylmethionine synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|P0A817|METK_ECOLI S-adenosylmethionine synthase OS=Escherichia coli (strain K12) GN=metK PE=1 SV=2 21 392 2.0E-142
sp|B1IT65|METK_ECOLC S-adenosylmethionine synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|P0A818|METK_ECOL6 S-adenosylmethionine synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metK PE=3 SV=2 21 392 2.0E-142
sp|Q0TDR0|METK_ECOL5 S-adenosylmethionine synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|A8A481|METK_ECOHS S-adenosylmethionine synthase OS=Escherichia coli O9:H4 (strain HS) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B1XFA4|METK_ECODH S-adenosylmethionine synthase OS=Escherichia coli (strain K12 / DH10B) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|C5A0L1|METK_ECOBW S-adenosylmethionine synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B7LYX2|METK_ECO8A S-adenosylmethionine synthase OS=Escherichia coli O8 (strain IAI1) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B7NI05|METK_ECO7I S-adenosylmethionine synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B5YQD9|METK_ECO5E S-adenosylmethionine synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|P0A819|METK_ECO57 S-adenosylmethionine synthase OS=Escherichia coli O157:H7 GN=metK PE=3 SV=2 21 392 2.0E-142
sp|B7LFK4|METK_ECO55 S-adenosylmethionine synthase OS=Escherichia coli (strain 55989 / EAEC) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B7UHY9|METK_ECO27 S-adenosylmethionine synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|A7ZR64|METK_ECO24 S-adenosylmethionine synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|C1CDB0|METK_STRZJ S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain JJA) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B5FUK0|METK_SALDC S-adenosylmethionine synthase OS=Salmonella dublin (strain CT_02021853) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B1JNQ2|METK_YERPY S-adenosylmethionine synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|Q666P5|METK_YERPS S-adenosylmethionine synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|A4TI83|METK_YERPP S-adenosylmethionine synthase OS=Yersinia pestis (strain Pestoides F) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|Q1CEX6|METK_YERPN S-adenosylmethionine synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|A9R314|METK_YERPG S-adenosylmethionine synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|Q8ZHG7|METK_YERPE S-adenosylmethionine synthase OS=Yersinia pestis GN=metK PE=3 SV=1 21 392 2.0E-142
sp|B2K0S7|METK_YERPB S-adenosylmethionine synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|Q1CB69|METK_YERPA S-adenosylmethionine synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|A7FEZ7|METK_YERP3 S-adenosylmethionine synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|Q7VUL5|METK_BORPE S-adenosylmethionine synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metK PE=3 SV=1 20 397 2.0E-142
sp|Q7W200|METK_BORPA S-adenosylmethionine synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metK PE=3 SV=2 20 397 2.0E-142
sp|Q7WQX8|METK_BORBR S-adenosylmethionine synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metK PE=3 SV=2 20 397 2.0E-142
sp|Q4FTH7|METK_PSYA2 S-adenosylmethionine synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=metK PE=3 SV=1 21 392 2.0E-142
sp|Q0KF39|METK_CUPNH S-adenosylmethionine synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=metK PE=3 SV=1 20 391 2.0E-142
sp|Q476V0|METK_CUPPJ S-adenosylmethionine synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=metK PE=3 SV=1 20 391 3.0E-142
sp|A6TDV1|METK_KLEP7 S-adenosylmethionine synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=metK PE=3 SV=1 21 392 4.0E-142
sp|B4THH4|METK_SALHS S-adenosylmethionine synthase OS=Salmonella heidelberg (strain SL476) GN=metK PE=3 SV=1 21 392 4.0E-142
sp|Q2RK28|METK_MOOTA S-adenosylmethionine synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=metK PE=3 SV=1 21 392 6.0E-142
sp|A8APG1|METK_CITK8 S-adenosylmethionine synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=metK PE=3 SV=1 21 392 7.0E-142
sp|Q0BAY8|METK_BURCM S-adenosylmethionine synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metK PE=3 SV=1 20 391 7.0E-142
sp|B1YPQ4|METK_BURA4 S-adenosylmethionine synthase OS=Burkholderia ambifaria (strain MC40-6) GN=metK PE=3 SV=1 20 391 7.0E-142
sp|C1FQQ5|METK_CLOBJ S-adenosylmethionine synthase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=metK PE=3 SV=1 21 392 9.0E-142
sp|Q5QVM7|METK_IDILO S-adenosylmethionine synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=metK PE=3 SV=1 21 392 9.0E-142
sp|Q47JN4|METK_DECAR S-adenosylmethionine synthase OS=Dechloromonas aromatica (strain RCB) GN=metK PE=3 SV=1 20 391 1.0E-141
sp|A5HY62|METK_CLOBH S-adenosylmethionine synthase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=metK PE=3 SV=1 21 392 1.0E-141
sp|A7FQI8|METK_CLOB1 S-adenosylmethionine synthase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=metK PE=3 SV=1 21 392 1.0E-141
sp|Q63YH5|METK_BURPS S-adenosylmethionine synthase OS=Burkholderia pseudomallei (strain K96243) GN=metK PE=1 SV=1 20 391 1.0E-141
sp|A3N4I1|METK_BURP6 S-adenosylmethionine synthase OS=Burkholderia pseudomallei (strain 668) GN=metK PE=3 SV=1 20 391 1.0E-141
sp|Q3JX94|METK_BURP1 S-adenosylmethionine synthase OS=Burkholderia pseudomallei (strain 1710b) GN=metK PE=3 SV=1 20 391 1.0E-141
sp|A3NQ73|METK_BURP0 S-adenosylmethionine synthase OS=Burkholderia pseudomallei (strain 1106a) GN=metK PE=3 SV=1 20 391 1.0E-141
sp|A1V7L5|METK_BURMS S-adenosylmethionine synthase OS=Burkholderia mallei (strain SAVP1) GN=metK PE=3 SV=1 20 391 1.0E-141
sp|Q62EZ1|METK_BURMA S-adenosylmethionine synthase OS=Burkholderia mallei (strain ATCC 23344) GN=metK PE=3 SV=1 20 391 1.0E-141
sp|A2S860|METK_BURM9 S-adenosylmethionine synthase OS=Burkholderia mallei (strain NCTC 10229) GN=metK PE=3 SV=1 20 391 1.0E-141
sp|A3MRQ4|METK_BURM7 S-adenosylmethionine synthase OS=Burkholderia mallei (strain NCTC 10247) GN=metK PE=3 SV=1 20 391 1.0E-141
sp|A7G9S1|METK_CLOBL S-adenosylmethionine synthase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=metK PE=3 SV=1 21 392 1.0E-141
sp|Q9ZMN5|METK_HELPJ S-adenosylmethionine synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=metK PE=3 SV=1 19 392 2.0E-141
sp|B1KST9|METK_CLOBM S-adenosylmethionine synthase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=metK PE=3 SV=1 21 392 2.0E-141
sp|A5UQL0|METK_ROSS1 S-adenosylmethionine synthase OS=Roseiflexus sp. (strain RS-1) GN=metK PE=3 SV=1 20 392 2.0E-141
sp|B1IE45|METK_CLOBK S-adenosylmethionine synthase OS=Clostridium botulinum (strain Okra / Type B1) GN=metK PE=3 SV=1 21 392 3.0E-141
sp|A9IH21|METK_BORPD S-adenosylmethionine synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=metK PE=3 SV=1 20 398 4.0E-141
sp|A4J945|METK_DESRM S-adenosylmethionine synthase OS=Desulfotomaculum reducens (strain MI-1) GN=metK PE=3 SV=1 21 391 4.0E-141
sp|A4JIQ4|METK_BURVG S-adenosylmethionine synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=metK PE=3 SV=1 20 391 5.0E-141
sp|A1K301|METK_AZOSB S-adenosylmethionine synthase OS=Azoarcus sp. (strain BH72) GN=metK PE=3 SV=1 20 392 6.0E-141
sp|A5CYJ7|METK_PELTS S-adenosylmethionine synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=metK PE=3 SV=1 21 392 7.0E-141
sp|Q3J7R5|METK_NITOC S-adenosylmethionine synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=metK PE=3 SV=1 22 397 1.0E-140
sp|A0KBF2|METK_BURCH S-adenosylmethionine synthase OS=Burkholderia cenocepacia (strain HI2424) GN=metK PE=3 SV=1 20 391 1.0E-140
sp|B1K0F2|METK_BURCC S-adenosylmethionine synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=metK PE=3 SV=1 20 391 1.0E-140
sp|Q1BSN9|METK_BURCA S-adenosylmethionine synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=metK PE=3 SV=1 20 391 1.0E-140
sp|Q2Y5Z1|METK_NITMU S-adenosylmethionine synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=metK PE=3 SV=1 20 391 2.0E-140
sp|B4E800|METK_BURCJ S-adenosylmethionine synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=metK PE=3 SV=1 20 391 2.0E-140
sp|Q39BZ1|METK_BURL3 S-adenosylmethionine synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metK PE=3 SV=1 20 391 2.0E-140
sp|B2JJY6|METK_BURP8 S-adenosylmethionine synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=metK PE=3 SV=1 20 391 2.0E-140
sp|Q8RCE4|METK_CALS4 S-adenosylmethionine synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=metK PE=3 SV=1 21 392 2.0E-140
sp|P50303|METK3_ACTCH S-adenosylmethionine synthase 3 (Fragment) OS=Actinidia chinensis GN=SAM3 PE=2 SV=1 50 398 3.0E-140
sp|B6JPU7|METK_HELP2 S-adenosylmethionine synthase OS=Helicobacter pylori (strain P12) GN=metK PE=3 SV=1 19 392 3.0E-140
sp|Q0AXL1|METK_SYNWW S-adenosylmethionine synthase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=metK PE=3 SV=1 21 392 3.0E-140
sp|B2US27|METK_HELPS S-adenosylmethionine synthase OS=Helicobacter pylori (strain Shi470) GN=metK PE=3 SV=1 19 392 3.0E-140
sp|A1SZJ9|METK_PSYIN S-adenosylmethionine synthase OS=Psychromonas ingrahamii (strain 37) GN=metK PE=3 SV=1 21 397 4.0E-140
sp|A5WDU0|METK_PSYWF S-adenosylmethionine synthase OS=Psychrobacter sp. (strain PRwf-1) GN=metK PE=3 SV=1 17 392 6.0E-140
sp|B5Z9W8|METK_HELPG S-adenosylmethionine synthase OS=Helicobacter pylori (strain G27) GN=metK PE=3 SV=1 19 392 7.0E-140
sp|Q3IDQ1|METK_PSEHT S-adenosylmethionine synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=metK PE=3 SV=1 21 392 7.0E-140
sp|A8MJT0|METK_ALKOO S-adenosylmethionine synthase OS=Alkaliphilus oremlandii (strain OhILAs) GN=metK PE=3 SV=1 21 392 9.0E-140
sp|Q1CUW4|METK_HELPH S-adenosylmethionine synthase OS=Helicobacter pylori (strain HPAG1) GN=metK PE=3 SV=1 19 392 1.0E-139
sp|Q9JY09|METK_NEIMB S-adenosylmethionine synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=metK PE=3 SV=1 20 392 2.0E-139
sp|B0VC98|METK_ACIBY S-adenosylmethionine synthase OS=Acinetobacter baumannii (strain AYE) GN=metK PE=3 SV=1 21 392 2.0E-139
sp|A6W3D6|METK_MARMS S-adenosylmethionine synthase OS=Marinomonas sp. (strain MWYL1) GN=metK PE=3 SV=1 21 392 2.0E-139
sp|A9M1V8|METK_NEIM0 S-adenosylmethionine synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=metK PE=3 SV=1 20 392 2.0E-139
sp|Q60CG7|METK_METCA S-adenosylmethionine synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=metK PE=3 SV=1 19 392 3.0E-139
sp|A1RN71|METK_SHESW S-adenosylmethionine synthase OS=Shewanella sp. (strain W3-18-1) GN=metK PE=3 SV=1 21 397 3.0E-139
sp|A4Y3R7|METK_SHEPC S-adenosylmethionine synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=metK PE=3 SV=1 21 397 3.0E-139
sp|B8FSB9|METK_DESHD S-adenosylmethionine synthase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=metK PE=3 SV=1 21 392 4.0E-139
sp|A1KS98|METK_NEIMF S-adenosylmethionine synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=metK PE=3 SV=1 20 392 4.0E-139
sp|P56460|METK_HELPY S-adenosylmethionine synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=metK PE=3 SV=1 19 392 4.0E-139
sp|Q0HRM1|METK_SHESR S-adenosylmethionine synthase OS=Shewanella sp. (strain MR-7) GN=metK PE=3 SV=1 21 391 5.0E-139
sp|Q0HM65|METK_SHESM S-adenosylmethionine synthase OS=Shewanella sp. (strain MR-4) GN=metK PE=3 SV=1 21 391 5.0E-139
sp|A0L0K9|METK_SHESA S-adenosylmethionine synthase OS=Shewanella sp. (strain ANA-3) GN=metK PE=3 SV=1 21 391 5.0E-139
sp|B0S2I6|METK_FINM2 S-adenosylmethionine synthase OS=Finegoldia magna (strain ATCC 29328) GN=metK PE=3 SV=1 19 392 5.0E-139
sp|Q5FAC0|METK_NEIG1 S-adenosylmethionine synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=metK PE=3 SV=2 20 392 7.0E-139
sp|P49612|METK1_PEA S-adenosylmethionine synthase 1 (Fragment) OS=Pisum sativum GN=SAMS1 PE=2 SV=2 44 398 8.0E-139
sp|Q9JVV6|METK_NEIMA S-adenosylmethionine synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=metK PE=3 SV=1 20 392 8.0E-139
sp|Q087Q9|METK_SHEFN S-adenosylmethionine synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=metK PE=3 SV=1 21 397 8.0E-139
sp|B8J8T3|METK_ANAD2 S-adenosylmethionine synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=metK PE=3 SV=1 16 392 9.0E-139
sp|B8CU43|METK_SHEPW S-adenosylmethionine synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=metK PE=3 SV=1 21 397 1.0E-138
sp|B4RQ36|METK_NEIG2 S-adenosylmethionine synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=metK PE=3 SV=1 20 392 1.0E-138
sp|A9L1M6|METK_SHEB9 S-adenosylmethionine synthase OS=Shewanella baltica (strain OS195) GN=metK PE=3 SV=1 21 397 1.0E-138
sp|A6WS79|METK_SHEB8 S-adenosylmethionine synthase OS=Shewanella baltica (strain OS185) GN=metK PE=3 SV=1 21 397 1.0E-138
sp|B8E5U7|METK_SHEB2 S-adenosylmethionine synthase OS=Shewanella baltica (strain OS223) GN=metK PE=3 SV=1 21 397 1.0E-138
sp|B2TK10|METK_CLOBB S-adenosylmethionine synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=metK PE=3 SV=1 21 392 1.0E-138
sp|A3M4V2|METK_ACIBT S-adenosylmethionine synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=metK PE=3 SV=2 21 392 1.0E-138
sp|B0VR30|METK_ACIBS S-adenosylmethionine synthase OS=Acinetobacter baumannii (strain SDF) GN=metK PE=3 SV=1 21 392 1.0E-138
sp|B2HYY9|METK_ACIBC S-adenosylmethionine synthase OS=Acinetobacter baumannii (strain ACICU) GN=metK PE=3 SV=1 21 392 1.0E-138
sp|B1I6C4|METK_DESAP S-adenosylmethionine synthase OS=Desulforudis audaxviator (strain MP104C) GN=metK PE=3 SV=1 21 392 1.0E-138
sp|Q48CH3|METK_PSE14 S-adenosylmethionine synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metK PE=3 SV=1 21 392 2.0E-138
sp|Q21NJ5|METK_SACD2 S-adenosylmethionine synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=metK PE=3 SV=1 21 392 2.0E-138
sp|A3D0T8|METK_SHEB5 S-adenosylmethionine synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=metK PE=3 SV=1 21 391 2.0E-138
sp|Q0A6D3|METK_ALKEH S-adenosylmethionine synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=metK PE=3 SV=1 20 392 2.0E-138
sp|B4ULF7|METK_ANASK S-adenosylmethionine synthase OS=Anaeromyxobacter sp. (strain K) GN=metK PE=3 SV=1 16 392 2.0E-138
sp|Q898W7|METK_CLOTE S-adenosylmethionine synthase OS=Clostridium tetani (strain Massachusetts / E88) GN=metK PE=3 SV=1 21 397 2.0E-138
sp|Q7NZF9|METK_CHRVO S-adenosylmethionine synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=metK PE=3 SV=1 20 392 2.0E-138
sp|A1S9A6|METK_SHEAM S-adenosylmethionine synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=metK PE=3 SV=1 21 392 3.0E-138
sp|Q17YQ7|METK_HELAH S-adenosylmethionine synthase OS=Helicobacter acinonychis (strain Sheeba) GN=metK PE=3 SV=1 19 392 3.0E-138
sp|A3QAX5|METK_SHELP S-adenosylmethionine synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=metK PE=3 SV=1 21 392 3.0E-138
sp|Q0VL83|METK_ALCBS S-adenosylmethionine synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=metK PE=3 SV=1 21 392 3.0E-138
sp|A0Q2Y4|METK_CLONN S-adenosylmethionine synthase OS=Clostridium novyi (strain NT) GN=metK PE=3 SV=1 21 392 3.0E-138
sp|A6Q1Z8|METK_NITSB S-adenosylmethionine synthase OS=Nitratiruptor sp. (strain SB155-2) GN=metK PE=3 SV=1 20 392 3.0E-138
sp|Q7M7Z2|METK_WOLSU S-adenosylmethionine synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=metK PE=3 SV=1 20 392 4.0E-138
sp|Q8EIB4|METK_SHEON S-adenosylmethionine synthase OS=Shewanella oneidensis (strain MR-1) GN=metK PE=3 SV=1 21 397 5.0E-138
sp|Q88AK7|METK_PSESM S-adenosylmethionine synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metK PE=3 SV=1 21 392 5.0E-138
sp|Q4ZM01|METK_PSEU2 S-adenosylmethionine synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metK PE=3 SV=1 21 392 5.0E-138
sp|A8FRL1|METK_SHESH S-adenosylmethionine synthase OS=Shewanella sediminis (strain HAW-EB3) GN=metK PE=3 SV=1 21 392 5.0E-138
sp|B2UZL0|METK_CLOBA S-adenosylmethionine synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=metK PE=3 SV=1 21 392 7.0E-138
sp|B2T1P7|METK_BURPP S-adenosylmethionine synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=metK PE=3 SV=1 20 391 8.0E-138
sp|Q3ZZN7|METK_DEHMC S-adenosylmethionine synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=metK PE=3 SV=1 20 392 8.0E-138
sp|A7HJA9|METK_FERNB S-adenosylmethionine synthase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=metK PE=3 SV=1 21 392 1.0E-137
sp|Q12FG9|METK_POLSJ S-adenosylmethionine synthase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=metK PE=3 SV=1 20 392 1.0E-137
sp|Q7URU7|METK_RHOBA S-adenosylmethionine synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=metK PE=3 SV=1 14 392 2.0E-137
sp|A8H0M7|METK_SHEPA S-adenosylmethionine synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=metK PE=3 SV=1 21 391 2.0E-137
sp|A4VRE8|METK_PSEU5 S-adenosylmethionine synthase OS=Pseudomonas stutzeri (strain A1501) GN=metK PE=3 SV=1 21 392 2.0E-137
sp|Q146W0|METK_BURXL S-adenosylmethionine synthase OS=Burkholderia xenovorans (strain LB400) GN=metK PE=3 SV=1 20 391 3.0E-137
sp|A4XPF8|METK_PSEMY S-adenosylmethionine synthase OS=Pseudomonas mendocina (strain ymp) GN=metK PE=3 SV=1 21 392 3.0E-137
sp|A2SKW6|METK_METPP S-adenosylmethionine synthase OS=Methylibium petroleiphilum (strain PM1) GN=metK PE=3 SV=1 20 392 3.0E-137
sp|C1DCT7|METK_LARHH S-adenosylmethionine synthase OS=Laribacter hongkongensis (strain HLHK9) GN=metK PE=3 SV=1 20 391 3.0E-137
sp|C3K3F5|METK_PSEFS S-adenosylmethionine synthase OS=Pseudomonas fluorescens (strain SBW25) GN=metK PE=3 SV=1 21 392 3.0E-137
sp|A7H6N1|METK_ANADF S-adenosylmethionine synthase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=metK PE=3 SV=1 16 392 3.0E-137
sp|Q7VFY5|METK_HELHP S-adenosylmethionine synthase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=metK PE=3 SV=1 19 392 4.0E-137
sp|Q2IM98|METK_ANADE S-adenosylmethionine synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=metK PE=3 SV=1 16 392 4.0E-137
sp|Q31EL0|METK_THICR S-adenosylmethionine synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=metK PE=3 SV=1 19 392 5.0E-137
sp|A5FRV2|METK_DEHMB S-adenosylmethionine synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=metK PE=3 SV=1 20 392 6.0E-137
sp|Q1I3X6|METK_PSEE4 S-adenosylmethionine synthase OS=Pseudomonas entomophila (strain L48) GN=metK PE=3 SV=1 21 392 6.0E-137
sp|Q12QA6|METK_SHEDO S-adenosylmethionine synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=metK PE=3 SV=1 21 391 7.0E-137
sp|Q7V2Y8|METK_PROMP S-adenosylmethionine synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=metK PE=3 SV=1 20 392 8.0E-137
sp|Q1R0L1|METK_CHRSD S-adenosylmethionine synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metK PE=3 SV=1 21 390 1.0E-136
sp|B7IEV2|METK_THEAB S-adenosylmethionine synthase OS=Thermosipho africanus (strain TCF52B) GN=metK PE=3 SV=1 21 392 1.0E-136
sp|B1KF18|METK_SHEWM S-adenosylmethionine synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=metK PE=3 SV=1 21 391 1.0E-136
sp|A1TKT9|METK_ACIAC S-adenosylmethionine synthase OS=Acidovorax citrulli (strain AAC00-1) GN=metK PE=3 SV=1 20 392 1.0E-136
sp|B9MDD1|METK_ACIET S-adenosylmethionine synthase OS=Acidovorax ebreus (strain TPSY) GN=metK PE=3 SV=1 20 392 2.0E-136
sp|B3PGF2|METK_CELJU S-adenosylmethionine synthase OS=Cellvibrio japonicus (strain Ueda107) GN=metK PE=3 SV=1 21 392 2.0E-136
sp|B8D7U1|METK_BUCAT S-adenosylmethionine synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=metK PE=3 SV=1 20 392 3.0E-136
sp|P57486|METK_BUCAI S-adenosylmethionine synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=metK PE=3 SV=1 20 392 3.0E-136
sp|B8D9I9|METK_BUCA5 S-adenosylmethionine synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=metK PE=3 SV=1 20 392 3.0E-136
sp|A4G977|METK_HERAR S-adenosylmethionine synthase OS=Herminiimonas arsenicoxydans GN=metK PE=3 SV=1 20 392 3.0E-136
sp|Q88D60|METK_PSEPK S-adenosylmethionine synthase OS=Pseudomonas putida (strain KT2440) GN=metK PE=3 SV=1 21 392 4.0E-136
sp|B0KLZ1|METK_PSEPG S-adenosylmethionine synthase OS=Pseudomonas putida (strain GB-1) GN=metK PE=3 SV=1 21 392 4.0E-136
sp|A5WA00|METK_PSEP1 S-adenosylmethionine synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=metK PE=3 SV=1 21 392 4.0E-136
sp|B1J2Z8|METK_PSEPW S-adenosylmethionine synthase OS=Pseudomonas putida (strain W619) GN=metK PE=3 SV=1 21 392 4.0E-136
sp|Q2SLT3|METK_HAHCH S-adenosylmethionine synthase OS=Hahella chejuensis (strain KCTC 2396) GN=metK PE=3 SV=1 21 392 5.0E-136
sp|Q5SHT8|METK_THET8 S-adenosylmethionine synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=metK PE=3 SV=1 21 392 5.0E-136
sp|Q72I53|METK_THET2 S-adenosylmethionine synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=metK PE=3 SV=2 21 392 5.0E-136
sp|A9BXF7|METK_DELAS S-adenosylmethionine synthase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=metK PE=3 SV=1 20 392 5.0E-136
sp|A1W3X4|METK_ACISJ S-adenosylmethionine synthase OS=Acidovorax sp. (strain JS42) GN=metK PE=3 SV=1 20 392 5.0E-136
sp|Q9RWM6|METK_DEIRA S-adenosylmethionine synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=metK PE=3 SV=1 21 397 5.0E-136
sp|Q3Z943|METK_DEHM1 S-adenosylmethionine synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=metK PE=3 SV=1 20 392 7.0E-136
sp|B5EN11|METK_ACIF5 S-adenosylmethionine synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=metK PE=3 SV=1 19 392 8.0E-136
sp|B7J551|METK_ACIF2 S-adenosylmethionine synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=metK PE=3 SV=1 19 392 8.0E-136
sp|C1CY25|METK_DEIDV S-adenosylmethionine synthase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=metK PE=3 SV=1 21 392 8.0E-136
sp|A2BUU2|METK_PROM5 S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=metK PE=3 SV=1 20 391 1.0E-135
sp|Q03GG8|METK_PEDPA S-adenosylmethionine synthase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=metK PE=3 SV=1 21 392 1.0E-135
sp|Q8Y347|METK_RALSO S-adenosylmethionine synthase OS=Ralstonia solanacearum (strain GMI1000) GN=metK PE=3 SV=1 20 391 2.0E-135
sp|Q47R14|METK_THEFY S-adenosylmethionine synthase OS=Thermobifida fusca (strain YX) GN=metK PE=3 SV=1 21 392 2.0E-135
sp|A6T2Z1|METK_JANMA S-adenosylmethionine synthase OS=Janthinobacterium sp. (strain Marseille) GN=metK PE=3 SV=1 20 392 3.0E-135
sp|Q83A78|METK_COXBU S-adenosylmethionine synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=metK PE=3 SV=1 19 392 4.0E-135
sp|C0QXK7|METK_BRAHW S-adenosylmethionine synthase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=metK PE=3 SV=1 19 392 5.0E-135
sp|B0TUB8|METK_SHEHH S-adenosylmethionine synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=metK PE=3 SV=1 21 391 5.0E-135
sp|A2C0F4|METK_PROM1 S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain NATL1A) GN=metK PE=3 SV=1 20 391 7.0E-135
sp|Q7V5A2|METK_PROMM S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=metK PE=3 SV=1 20 391 7.0E-135
sp|Q9L0Y3|METK_STRCO S-adenosylmethionine synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=metK PE=3 SV=1 21 392 8.0E-135
sp|A9N9E2|METK_COXBR S-adenosylmethionine synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=metK PE=3 SV=1 19 392 8.0E-135
sp|B6J3Q9|METK_COXB2 S-adenosylmethionine synthase OS=Coxiella burnetii (strain CbuG_Q212) GN=metK PE=3 SV=1 19 392 8.0E-135
sp|Q1LU70|METK_BAUCH S-adenosylmethionine synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=metK PE=3 SV=1 21 392 9.0E-135
sp|Q3K5E8|METK_PSEPF S-adenosylmethionine synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=metK PE=3 SV=1 21 392 9.0E-135
sp|Q4K4I7|METK_PSEF5 S-adenosylmethionine synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metK PE=3 SV=1 21 392 1.0E-134
sp|B1Y6S3|METK_LEPCP S-adenosylmethionine synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=metK PE=3 SV=1 20 392 1.0E-134
sp|A9KD87|METK_COXBN S-adenosylmethionine synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=metK PE=3 SV=1 19 392 1.0E-134
sp|Q2J8P2|METK1_FRASC S-adenosylmethionine synthase 1 OS=Frankia sp. (strain CcI3) GN=metK1 PE=3 SV=1 21 392 2.0E-134
sp|Q5P2V5|METK_AROAE S-adenosylmethionine synthase OS=Aromatoleum aromaticum (strain EbN1) GN=metK PE=3 SV=1 20 391 2.0E-134
sp|A6LNU4|METK_THEM4 S-adenosylmethionine synthase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=metK PE=3 SV=1 21 392 2.0E-134
sp|C4K3W7|METK_HAMD5 S-adenosylmethionine synthase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=metK PE=3 SV=1 16 391 2.0E-134
sp|Q97F85|METK_CLOAB S-adenosylmethionine synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=metK PE=3 SV=1 21 392 2.0E-134
sp|Q46H57|METK_PROMT S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain NATL2A) GN=metK PE=3 SV=1 20 391 2.0E-134
sp|A4T0F0|METK_POLSQ S-adenosylmethionine synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=metK PE=3 SV=1 20 392 2.0E-134
sp|C5CQF1|METK_VARPS S-adenosylmethionine synthase OS=Variovorax paradoxus (strain S110) GN=metK PE=3 SV=1 20 391 2.0E-134
sp|Q6LMM8|METK_PHOPR S-adenosylmethionine synthase OS=Photobacterium profundum GN=metK PE=3 SV=1 21 391 2.0E-134
sp|C5BAV4|METK_EDWI9 S-adenosylmethionine synthase OS=Edwardsiella ictaluri (strain 93-146) GN=metK PE=3 SV=1 21 392 2.0E-134
sp|B2FPC7|METK_STRMK S-adenosylmethionine synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=metK PE=3 SV=1 19 392 3.0E-134
sp|Q6D081|METK_PECAS S-adenosylmethionine synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metK PE=3 SV=1 21 392 3.0E-134
sp|Q8K9E5|METK_BUCAP S-adenosylmethionine synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=metK PE=3 SV=1 20 392 3.0E-134
sp|C6DFI3|METK_PECCP S-adenosylmethionine synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=metK PE=3 SV=1 21 392 3.0E-134
sp|Q9X4Q2|METK_STRST S-adenosylmethionine synthase OS=Streptomyces spectabilis GN=metK PE=3 SV=1 21 392 4.0E-134
sp|B4SK03|METK_STRM5 S-adenosylmethionine synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=metK PE=3 SV=1 19 392 5.0E-134
sp|B6J6H0|METK_COXB1 S-adenosylmethionine synthase OS=Coxiella burnetii (strain CbuK_Q154) GN=metK PE=3 SV=1 19 392 5.0E-134
sp|A5GR07|METK_SYNR3 S-adenosylmethionine synthase OS=Synechococcus sp. (strain RCC307) GN=metK PE=3 SV=1 20 391 6.0E-134
sp|Q827Q0|METK_STRAW S-adenosylmethionine synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=metK PE=3 SV=1 21 392 6.0E-134
sp|Q30PN0|METK_SULDN S-adenosylmethionine synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=metK PE=3 SV=1 20 391 7.0E-134
sp|Q65UT4|METK_MANSM S-adenosylmethionine synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metK PE=3 SV=1 19 392 7.0E-134
sp|Q9KUP3|METK_VIBCH S-adenosylmethionine synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=metK PE=3 SV=1 21 391 8.0E-134
sp|Q7WYG5|METK_LEGJE S-adenosylmethionine synthase OS=Legionella jeonii GN=metK PE=3 SV=1 21 392 9.0E-134
sp|Q5GW76|METK_XANOR S-adenosylmethionine synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=metK PE=3 SV=1 19 392 1.0E-133
sp|B2SPP5|METK_XANOP S-adenosylmethionine synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=metK PE=3 SV=1 19 392 1.0E-133
sp|Q2NZF1|METK_XANOM S-adenosylmethionine synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=metK PE=3 SV=1 19 392 1.0E-133
sp|Q3BXB7|METK_XANC5 S-adenosylmethionine synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=metK PE=3 SV=1 19 392 1.0E-133
sp|Q8PP75|METK_XANAC S-adenosylmethionine synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metK PE=3 SV=1 19 392 1.0E-133
sp|Q0AEV7|METK_NITEC S-adenosylmethionine synthase OS=Nitrosomonas eutropha (strain C91) GN=metK PE=3 SV=1 19 392 1.0E-133
sp|A1WSC8|METK_VEREI S-adenosylmethionine synthase OS=Verminephrobacter eiseniae (strain EF01-2) GN=metK PE=3 SV=1 20 392 1.0E-133
sp|Q741G5|METK_MYCPA S-adenosylmethionine synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=metK PE=3 SV=1 21 392 1.0E-133
sp|Q9I5Z0|METK_PSEAE S-adenosylmethionine synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metK PE=3 SV=1 21 392 1.0E-133
sp|Q02TL9|METK_PSEAB S-adenosylmethionine synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metK PE=3 SV=1 21 392 1.0E-133
sp|B7V4D3|METK_PSEA8 S-adenosylmethionine synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=metK PE=3 SV=1 21 392 1.0E-133
sp|A6UZ09|METK_PSEA7 S-adenosylmethionine synthase OS=Pseudomonas aeruginosa (strain PA7) GN=metK PE=3 SV=1 21 392 1.0E-133
sp|P57897|METK_PASMU S-adenosylmethionine synthase OS=Pasteurella multocida (strain Pm70) GN=metK PE=3 SV=1 20 392 1.0E-133
sp|C1DKE3|METK_AZOVD S-adenosylmethionine synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=metK PE=3 SV=1 21 392 2.0E-133
sp|Q8D2N8|METK_WIGBR S-adenosylmethionine synthase OS=Wigglesworthia glossinidia brevipalpis GN=metK PE=3 SV=1 20 392 2.0E-133
sp|A2CBU3|METK_PROM3 S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=metK PE=3 SV=1 20 391 2.0E-133
sp|A6QBY6|METK_SULNB S-adenosylmethionine synthase OS=Sulfurovum sp. (strain NBC37-1) GN=metK PE=3 SV=1 20 392 2.0E-133
[Show less]

GO

GO Term Description Terminal node
GO:0006556 S-adenosylmethionine biosynthetic process Yes
GO:0004478 methionine adenosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0016740 transferase activity No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0009108 coenzyme biosynthetic process No
GO:0017144 drug metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0006732 coenzyme metabolic process No
GO:0071704 organic substance metabolic process No
GO:0051188 cofactor biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0044272 sulfur compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0046500 S-adenosylmethionine metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0003824 catalytic activity No
GO:0051186 cofactor metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1413
MAAVNGTNGVHNASSPHGTFLFTSESVGEGHPDKIADQVSDAILDACLAEDPLSKVACETATKTGMIMVFGEITT
SAKLDYQKIVRDTVKGIGYDDSDKGFDYKTLNLLVAIEQQSPDIAQGLHYEQALERLGAGDQGIMFGYATDETPE
LFPLTLMLAHKLNAAMAAARRDGSLPWLRPDTKTQVTVEYKHDHGAVVPVRVHTVVVSAQHSADISTEELRKEIK
DKIIKKTIPAKYLDDKTIYHIQPSGLFIIGGPQGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDFSKVDRSAAYVG
RWIAKSLVAAGLCRRALVQLSYAIGVAEPLSIYVDTYGTSDKSSDELVAIIRDNFDLRPGVIVRSLDLDRPMYLQ
TAKNGHFGTNQQFSWEKPKALKF*
Coding >Hirsu2|1413
ATGGCTGCGGTCAACGGCACCAACGGCGTCCACAATGCCAGCTCCCCGCACGGCACCTTTCTCTTCACTTCCGAG
TCGGTAGGCGAGGGTCACCCCGACAAGATCGCCGACCAGGTCTCGGACGCAATCCTCGACGCCTGCCTGGCCGAG
GACCCGCTGTCCAAGGTGGCGTGCGAGACGGCGACCAAGACGGGCATGATCATGGTCTTCGGCGAGATCACCACG
TCGGCCAAGCTCGACTACCAGAAGATCGTCCGCGACACGGTCAAGGGCATCGGCTACGACGACTCGGACAAGGGC
TTCGACTACAAGACGCTCAACCTCCTCGTCGCCATCGAGCAGCAGTCGCCCGACATCGCCCAGGGCCTGCACTAC
GAGCAGGCCCTCGAGCGCCTCGGCGCCGGCGACCAGGGCATCATGTTCGGCTACGCCACGGACGAGACGCCCGAG
CTCTTCCCCCTCACCCTCATGCTGGCCCACAAGCTCAACGCCGCCATGGCCGCCGCCCGCCGCGACGGCTCCCTG
CCCTGGCTGCGGCCCGACACCAAGACGCAGGTGACGGTCGAGTACAAGCACGACCACGGCGCCGTCGTCCCCGTC
CGCGTCCACACCGTCGTCGTCTCCGCCCAGCACTCGGCCGACATCAGCACCGAGGAGCTGCGCAAGGAGATCAAG
GACAAGATCATCAAGAAGACGATCCCGGCCAAGTACCTCGACGACAAGACCATTTACCATATCCAACCGTCCGGC
CTCTTCATCATCGGCGGGCCCCAGGGCGACGCCGGCCTGACCGGCCGCAAGATCATCGTCGACACGTACGGCGGC
TGGGGCGCCCACGGCGGCGGCGCCTTCTCCGGCAAGGACTTCTCCAAGGTCGACCGCTCGGCCGCCTACGTCGGC
CGGTGGATCGCCAAGTCGCTCGTGGCGGCCGGCCTCTGCCGCCGGGCCCTCGTGCAGCTCTCGTACGCCATCGGC
GTCGCCGAGCCCCTCTCCATCTACGTCGACACGTACGGCACGTCGGACAAGTCGTCGGACGAGCTCGTCGCCATC
ATCCGCGACAACTTCGACCTGCGGCCCGGCGTCATCGTCCGCTCCCTCGACCTCGACCGGCCCATGTACCTGCAG
ACGGCCAAGAACGGCCACTTTGGAACCAACCAGCAGTTCAGCTGGGAGAAGCCCAAGGCGCTCAAGTTCTGA
Transcript >Hirsu2|1413
ATGGCTGCGGTCAACGGCACCAACGGCGTCCACAATGCCAGCTCCCCGCACGGCACCTTTCTCTTCACTTCCGAG
TCGGTAGGCGAGGGTCACCCCGACAAGATCGCCGACCAGGTCTCGGACGCAATCCTCGACGCCTGCCTGGCCGAG
GACCCGCTGTCCAAGGTGGCGTGCGAGACGGCGACCAAGACGGGCATGATCATGGTCTTCGGCGAGATCACCACG
TCGGCCAAGCTCGACTACCAGAAGATCGTCCGCGACACGGTCAAGGGCATCGGCTACGACGACTCGGACAAGGGC
TTCGACTACAAGACGCTCAACCTCCTCGTCGCCATCGAGCAGCAGTCGCCCGACATCGCCCAGGGCCTGCACTAC
GAGCAGGCCCTCGAGCGCCTCGGCGCCGGCGACCAGGGCATCATGTTCGGCTACGCCACGGACGAGACGCCCGAG
CTCTTCCCCCTCACCCTCATGCTGGCCCACAAGCTCAACGCCGCCATGGCCGCCGCCCGCCGCGACGGCTCCCTG
CCCTGGCTGCGGCCCGACACCAAGACGCAGGTGACGGTCGAGTACAAGCACGACCACGGCGCCGTCGTCCCCGTC
CGCGTCCACACCGTCGTCGTCTCCGCCCAGCACTCGGCCGACATCAGCACCGAGGAGCTGCGCAAGGAGATCAAG
GACAAGATCATCAAGAAGACGATCCCGGCCAAGTACCTCGACGACAAGACCATTTACCATATCCAACCGTCCGGC
CTCTTCATCATCGGCGGGCCCCAGGGCGACGCCGGCCTGACCGGCCGCAAGATCATCGTCGACACGTACGGCGGC
TGGGGCGCCCACGGCGGCGGCGCCTTCTCCGGCAAGGACTTCTCCAAGGTCGACCGCTCGGCCGCCTACGTCGGC
CGGTGGATCGCCAAGTCGCTCGTGGCGGCCGGCCTCTGCCGCCGGGCCCTCGTGCAGCTCTCGTACGCCATCGGC
GTCGCCGAGCCCCTCTCCATCTACGTCGACACGTACGGCACGTCGGACAAGTCGTCGGACGAGCTCGTCGCCATC
ATCCGCGACAACTTCGACCTGCGGCCCGGCGTCATCGTCCGCTCCCTCGACCTCGACCGGCCCATGTACCTGCAG
ACGGCCAAGAACGGCCACTTTGGAACCAACCAGCAGTTCAGCTGGGAGAAGCCCAAGGCGCTCAAGTTCTGA
Gene >Hirsu2|1413
ATGGCTGCGGTCAACGGCACCAACGGCGTCCACAATGCCAGCTCCCCGCACGGCACCTTTCTCTTCACTGTAAGC
CTTCAGCCGTGCCGGCCCTGGGCCCTGTCTGCCCGTCTCTAACCGTGCCGTCTCCTCCGCCTTTGCGCTTCGCCA
GTCCGAGTCGGTAGGCGAGGGTCACCCCGACAAGATCGCCGACCAGGTCTCGGACGCAATCCTCGACGCCTGCCT
GGCCGAGGACCCGCTGTCCAAGGTGGCGTGCGAGACGGCGACCAAGACGGGCATGATCATGGTCTTCGGCGAGAT
CACCACGTCGGCCAAGCTCGACTACCAGAAGATCGTCCGCGACACGGTCAAGGGCATCGGCTACGACGACTCGGA
CAAGGGCTTCGACTACAAGACGCTCAACCTCCTCGTCGCCATCGAGCAGCAGTCGCCCGACATCGCCCAGGGCCT
GCACTACGAGCAGGCCCTCGAGCGCCTCGGCGCCGGCGACCAGGGCATCATGTTCGGCTACGCCACGGACGAGAC
GCCCGAGCTCTTCCCCCTCACCCTCATGCTGGCCCACAAGCTCAACGCCGCCATGGCCGCCGCCCGCCGCGACGG
CTCCCTGCCCTGGCTGCGGCCCGACACCAAGACGCAGGTGACGGTCGAGTACAAGCACGACCACGGCGCCGTCGT
CCCCGTCCGCGTCCACACCGTCGTCGTCTCCGCCCAGCACTCGGCCGACATCAGCACCGAGGAGCTGCGCAAGGA
GATCAAGGACAAGATCATCAAGAAGACGATCCCGGCCAAGTACCTCGACGACAAGACCATTTACCATGTGAGACC
CCCTTGTGCCTCGCCTGCCTCTCGCACTGCTGGTCTACCCTGTGCACATTGCTCACTCGCTTCCCCTGCGCACAG
ATCCAACCGTCCGGCCTCTTCATCATCGGCGGGCCCCAGGGCGACGCCGGCCTGACCGGCCGCAAGATCATCGTC
GACACGTACGGCGGCTGGGGCGCCCACGGCGGCGGCGCCTTCTCCGGCAAGGACTTCTCCAAGGTCGACCGCTCG
GCCGCCTACGTCGGCCGGTGGATCGCCAAGTCGCTCGTGGCGGCCGGCCTCTGCCGCCGGGCCCTCGTGCAGCTC
TCGTACGCCATCGGCGTCGCCGAGCCCCTCTCCATCTACGTCGACACGTACGGCACGTCGGACAAGTCGTCGGAC
GAGCTCGTCGCCATCATCCGCGACAACTTCGACCTGCGGCCCGGCGTCATCGTCCGCTCCCTCGACCTCGACCGG
CCCATGTACCTGCAGACGGCCAAGAACGGCCACTTTGGAACCAACCAGCAGTTCAGCTGGGAGAAGCCCAAGGCG
CTCAAGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail