Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1405
Gene name
LocationContig_1304:6749..7475
Strand-
Gene length (bp)726
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 3.1E-29 4 211
PF07690 MFS_1 Major Facilitator Superfamily 7.2E-10 14 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 1 220 1.0E-25
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 7 211 2.0E-12
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 3 222 1.0E-08
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 9 212 2.0E-08
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 1 224 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 1 220 1.0E-25
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 7 211 2.0E-12
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 3 222 1.0E-08
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 9 212 2.0E-08
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 1 224 3.0E-08
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 5 211 3.0E-08
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 1 231 2.0E-07
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 1 215 5.0E-07
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 4 239 5.0E-07
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 8 214 1.0E-06
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 7 212 2.0E-06
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 1 224 4.0E-06
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 4 218 5.0E-06
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 4 211 7.0E-06
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 8 211 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 11 33 22
2 48 70 22
3 77 96 19
4 106 128 22
5 148 170 22
6 175 197 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1405
LLASPANRRRLGLCFATALFSQSSGNLLVSSYLTQILRDTGVEADRDVTLVNGMVALWQYMVALAVAALVDRFRR
RTFFLIGSAGVALTFVAWTVAAQQYLERGSLAAGRLVLACIFLFQAFYTLAWTNLVVTYPLEVVTYQMRAKAWAF
VLLTIQVASIFGGYVNPVGLQSIGWKFYIYYCVWVSLIFFVVYFFFVETAGPTLEELAYLFDGDEANKAAPEPDA
AAGRMQAETAEEAKAR*
Coding >Hirsu2|1405
CTGCTGGCCTCGCCCGCCAACCGCCGCCGCCTCGGCCTCTGCTTCGCCACCGCCCTCTTCAGCCAGAGCTCGGGC
AACCTGCTGGTGTCGAGCTACCTGACGCAGATCCTGCGCGACACGGGCGTCGAGGCCGACCGCGACGTCACCCTC
GTCAACGGCATGGTCGCCCTGTGGCAGTACATGGTCGCCCTGGCCGTCGCCGCCCTCGTCGACCGCTTCCGCCGC
CGCACCTTCTTCCTCATCGGCTCCGCCGGCGTCGCCCTGACCTTTGTCGCCTGGACCGTCGCCGCCCAGCAGTAC
CTCGAGCGCGGCTCGCTCGCCGCCGGCCGCCTCGTCCTCGCCTGCATCTTCCTCTTCCAGGCCTTCTACACCCTG
GCCTGGACCAACCTGGTCGTCACCTACCCGCTCGAGGTCGTCACCTACCAGATGCGCGCCAAGGCCTGGGCCTTT
GTCCTGCTCACCATTCAGGTCGCCTCCATCTTCGGCGGCTACGTCAACCCCGTCGGCCTCCAGAGCATCGGCTGG
AAGTTCTACATCTACTACTGCGTCTGGGTCTCCCTCATCTTCTTCGTCGTCTACTTCTTCTTCGTCGAGACCGCC
GGCCCGACCCTCGAGGAGCTCGCCTATCTGTTCGACGGCGACGAGGCCAACAAGGCCGCGCCCGAACCCGACGCC
GCCGCCGGCAGGATGCAGGCAGAGACGGCGGAGGAGGCAAAGGCCCGATGA
Transcript >Hirsu2|1405
CTGCTGGCCTCGCCCGCCAACCGCCGCCGCCTCGGCCTCTGCTTCGCCACCGCCCTCTTCAGCCAGAGCTCGGGC
AACCTGCTGGTGTCGAGCTACCTGACGCAGATCCTGCGCGACACGGGCGTCGAGGCCGACCGCGACGTCACCCTC
GTCAACGGCATGGTCGCCCTGTGGCAGTACATGGTCGCCCTGGCCGTCGCCGCCCTCGTCGACCGCTTCCGCCGC
CGCACCTTCTTCCTCATCGGCTCCGCCGGCGTCGCCCTGACCTTTGTCGCCTGGACCGTCGCCGCCCAGCAGTAC
CTCGAGCGCGGCTCGCTCGCCGCCGGCCGCCTCGTCCTCGCCTGCATCTTCCTCTTCCAGGCCTTCTACACCCTG
GCCTGGACCAACCTGGTCGTCACCTACCCGCTCGAGGTCGTCACCTACCAGATGCGCGCCAAGGCCTGGGCCTTT
GTCCTGCTCACCATTCAGGTCGCCTCCATCTTCGGCGGCTACGTCAACCCCGTCGGCCTCCAGAGCATCGGCTGG
AAGTTCTACATCTACTACTGCGTCTGGGTCTCCCTCATCTTCTTCGTCGTCTACTTCTTCTTCGTCGAGACCGCC
GGCCCGACCCTCGAGGAGCTCGCCTATCTGTTCGACGGCGACGAGGCCAACAAGGCCGCGCCCGAACCCGACGCC
GCCGCCGGCAGGATGCAGGCAGAGACGGCGGAGGAGGCAAAGGCCCGATGA
Gene >Hirsu2|1405
CTGCTGGCCTCGCCCGCCAACCGCCGCCGCCTCGGCCTCTGCTTCGCCACCGCCCTCTTCAGCCAGAGCTCGGGC
AACCTGCTGGTGTCGAGCTACCTGACGCAGATCCTGCGCGACACGGGCGTCGAGGCCGACCGCGACGTCACCCTC
GTCAACGGCATGGTCGCCCTGTGGCAGTACATGGTCGCCCTGGCCGTCGCCGCCCTCGTCGACCGCTTCCGCCGC
CGCACCTTCTTCCTCATCGGCTCCGCCGGCGTCGCCCTGACCTTTGTCGCCTGGACCGTCGCCGCCCAGCAGTAC
CTCGAGCGCGGCTCGCTCGCCGCCGGCCGCCTCGTCCTCGCCTGCATCTTCCTCTTCCAGGCCTTCTACACCCTG
GCCTGGACCAACCTGGTCGTCACCTACCCGCTCGAGGTCGTCACCTACCAGATGCGCGCCAAGGCCTGGGCCTTT
GTCCTGCTCACCATTCAGGTCGCCTCCATCTTCGGCGGCTACGTCAACCCCGTCGGCCTCCAGAGCATCGGCTGG
AAGTTCTACATCTACTACTGCGTCTGGGTCTCCCTCATCTTCTTCGTCGTCTACTTCTTCTTCGTCGAGACCGCC
GGCCCGACCCTCGAGGAGCTCGCCTATCTGTTCGACGGCGACGAGGCCAACAAGGCCGCGCCCGAACCCGACGCC
GCCGCCGGCAGGATGCAGGCAGAGACGGCGGAGGAGGCAAAGGCCCGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail