Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1403
Gene name
LocationContig_1304:2813..4896
Strand-
Gene length (bp)2083
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 7.0E-79 65 509
PF07690 MFS_1 Major Facilitator Superfamily 2.8E-23 69 446
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.7E-05 91 235

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 63 509 5.0E-57
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 59 533 3.0E-52
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 54 507 6.0E-51
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 54 507 6.0E-51
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 52 507 8.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 63 509 5.0E-57
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 59 533 3.0E-52
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 54 507 6.0E-51
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 54 507 6.0E-51
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 52 507 8.0E-48
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 52 507 8.0E-48
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 67 507 2.0E-47
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 55 507 5.0E-47
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 66 507 1.0E-46
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 67 507 1.0E-45
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 54 507 1.0E-45
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 59 506 3.0E-45
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 55 548 1.0E-44
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 59 513 3.0E-44
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 66 514 8.0E-44
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 51 507 3.0E-43
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 62 507 4.0E-43
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 66 507 5.0E-43
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 67 506 8.0E-42
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 57 511 2.0E-41
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 41 409 4.0E-41
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 103 512 5.0E-41
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 67 523 7.0E-41
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 78 506 9.0E-41
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 66 510 1.0E-40
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 10 510 1.0E-40
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 51 510 6.0E-40
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 61 506 1.0E-39
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 59 520 2.0E-39
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 66 512 1.0E-38
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 67 512 2.0E-38
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 50 395 2.0E-38
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 43 528 3.0E-38
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 59 509 6.0E-38
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 85 521 1.0E-37
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 75 507 2.0E-37
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 57 507 3.0E-37
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 21 395 2.0E-36
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 59 522 1.0E-35
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 21 395 2.0E-35
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 100 509 4.0E-35
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 67 512 1.0E-34
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 67 509 6.0E-34
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 67 391 7.0E-34
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 90 510 1.0E-33
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 125 506 1.0E-33
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 46 396 1.0E-33
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 67 514 2.0E-33
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 67 514 2.0E-33
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 54 507 2.0E-33
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 94 506 4.0E-33
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 67 509 4.0E-33
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 66 509 7.0E-33
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 67 507 2.0E-32
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 62 512 3.0E-32
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 51 518 3.0E-32
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 82 511 7.0E-32
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 63 516 2.0E-31
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 2 522 3.0E-31
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 94 507 4.0E-31
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 21 374 7.0E-31
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 125 553 1.0E-30
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 125 512 2.0E-30
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 94 507 2.0E-30
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 63 511 2.0E-30
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 66 522 3.0E-30
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 65 507 3.0E-30
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 59 507 4.0E-30
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 61 509 5.0E-30
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 74 506 5.0E-30
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 61 509 7.0E-30
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 120 506 9.0E-30
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 94 507 1.0E-29
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 62 534 2.0E-29
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 90 516 2.0E-29
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 36 507 3.0E-29
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 88 507 3.0E-29
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 90 514 4.0E-29
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 59 374 4.0E-29
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 59 507 8.0E-29
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 59 507 8.0E-29
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 59 374 1.0E-28
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 59 507 1.0E-28
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 59 507 1.0E-28
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 88 507 1.0E-28
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 65 507 2.0E-28
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 64 374 2.0E-28
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 88 507 2.0E-28
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 36 507 2.0E-28
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 59 507 3.0E-28
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 59 507 4.0E-28
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 65 554 5.0E-28
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 61 534 5.0E-28
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 59 374 7.0E-28
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 61 509 7.0E-28
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 59 403 7.0E-28
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 88 507 1.0E-27
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 59 507 1.0E-27
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 90 516 1.0E-27
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 36 507 2.0E-27
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 62 531 4.0E-27
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 61 509 4.0E-27
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 119 548 4.0E-27
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 119 548 4.0E-27
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 18 534 5.0E-27
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 59 507 6.0E-27
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 67 512 8.0E-27
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 58 506 1.0E-26
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 18 534 1.0E-26
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 61 548 1.0E-26
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 100 512 2.0E-26
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 18 534 2.0E-26
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 59 507 2.0E-26
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 36 507 2.0E-26
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 59 507 3.0E-26
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 36 507 3.0E-26
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 62 531 3.0E-26
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 56 511 5.0E-26
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 51 507 7.0E-26
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 36 507 1.0E-25
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 119 548 1.0E-25
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 108 512 2.0E-25
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 62 510 3.0E-25
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 62 512 3.0E-25
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 32 507 4.0E-25
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 108 512 4.0E-25
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 100 512 9.0E-25
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 100 512 1.0E-24
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 119 507 1.0E-24
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 122 512 1.0E-24
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 75 514 2.0E-24
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 100 512 3.0E-24
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 60 507 4.0E-24
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 122 512 6.0E-24
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 119 513 6.0E-24
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 60 507 6.0E-24
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 82 511 8.0E-24
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 61 534 9.0E-24
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 68 549 1.0E-23
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 62 512 1.0E-23
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 60 507 2.0E-23
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 60 408 2.0E-23
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 62 534 3.0E-23
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 60 402 8.0E-23
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 62 522 9.0E-23
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 57 536 1.0E-22
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 62 506 1.0E-22
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 125 506 2.0E-22
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 31 510 2.0E-22
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 100 534 3.0E-22
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 62 512 3.0E-22
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 70 512 4.0E-22
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 125 506 5.0E-22
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 62 507 6.0E-22
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 99 506 6.0E-22
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 62 531 1.0E-21
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 125 506 1.0E-21
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 62 531 1.0E-21
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 4 531 2.0E-21
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 125 506 2.0E-21
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 62 507 7.0E-21
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 125 506 8.0E-21
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 152 506 8.0E-21
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 125 506 9.0E-21
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 95 509 2.0E-20
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 125 506 2.0E-20
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 100 512 2.0E-20
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 125 506 3.0E-20
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 110 512 3.0E-20
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 121 506 4.0E-20
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 125 506 5.0E-20
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 100 532 5.0E-20
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 121 521 6.0E-20
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 90 511 6.0E-20
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 60 243 6.0E-20
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 59 522 7.0E-20
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 125 506 7.0E-20
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 56 512 1.0E-19
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 121 506 1.0E-19
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 152 515 2.0E-19
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 63 284 2.0E-19
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 149 506 2.0E-19
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 101 531 2.0E-19
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 121 506 2.0E-19
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 64 514 3.0E-19
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 62 262 3.0E-19
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 121 506 3.0E-19
sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=1 SV=3 125 506 4.0E-19
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 125 506 4.0E-19
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 125 506 6.0E-19
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 121 506 6.0E-19
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 125 506 7.0E-19
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 57 507 7.0E-19
sp|Q9JJZ1|GTR8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1 125 506 9.0E-19
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 57 507 2.0E-18
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 110 512 2.0E-18
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 110 512 3.0E-18
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 125 506 3.0E-18
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1 100 532 4.0E-18
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 63 507 4.0E-18
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 125 421 8.0E-18
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 70 284 1.0E-17
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 110 512 2.0E-17
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 100 512 5.0E-17
sp|O95528|GTR10_HUMAN Solute carrier family 2, facilitated glucose transporter member 10 OS=Homo sapiens GN=SLC2A10 PE=1 SV=2 62 406 1.0E-16
sp|Q9JIF3|GTR8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=2 125 506 1.0E-16
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 150 507 2.0E-16
sp|P46408|GTR5_RABIT Solute carrier family 2, facilitated glucose transporter member 5 OS=Oryctolagus cuniculus GN=SLC2A5 PE=2 SV=1 100 506 3.0E-16
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 109 513 5.0E-16
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 90 508 3.0E-15
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 101 553 2.0E-13
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 63 505 3.0E-12
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 94 339 5.0E-12
sp|Q12407|YD199_YEAST Putative metabolite transport protein YDL199C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL199C PE=1 SV=1 31 507 8.0E-12
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 86 507 3.0E-11
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 90 374 4.0E-11
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 109 445 2.0E-10
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 22 264 2.0E-10
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 130 507 4.0E-10
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 95 507 6.0E-10
sp|Q5RLM2|S22A7_RAT Solute carrier family 22 member 7 OS=Rattus norvegicus GN=Slc22a7 PE=1 SV=1 99 505 4.0E-09
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 22 264 6.0E-09
sp|Q66J54|S226A_XENLA Solute carrier family 22 member 6-A OS=Xenopus laevis GN=slc22a6-a PE=2 SV=1 109 528 7.0E-09
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 424 527 8.0E-09
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 99 505 8.0E-09
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 304 507 1.0E-08
sp|Q8VHD6|GTR10_MOUSE Solute carrier family 2, facilitated glucose transporter member 10 OS=Mus musculus GN=Slc2a10 PE=2 SV=1 62 394 1.0E-08
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 297 506 2.0E-08
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 32 264 2.0E-08
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 58 505 2.0E-08
sp|P53403|GTR3_DROME Glucose transporter type 3 OS=Drosophila melanogaster GN=Glut3 PE=2 SV=1 95 515 2.0E-08
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 58 505 3.0E-08
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 58 505 3.0E-08
sp|Q8H6G7|PHT19_ORYSJ Probable inorganic phosphate transporter 1-9 OS=Oryza sativa subsp. japonica GN=PHT1-9 PE=2 SV=2 108 505 4.0E-08
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 58 505 5.0E-08
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 304 506 9.0E-08
sp|Q8FDU9|NANT2_ECOL6 Putative sialic acid transporter 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT2 PE=3 SV=1 50 243 4.0E-07
sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=1 SV=2 100 505 8.0E-07
sp|Q5EXK5|MHBT_KLEOX 3-hydroxybenzoate transporter MhbT OS=Klebsiella oxytoca GN=mhbT PE=1 SV=1 119 451 8.0E-07
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 411 507 1.0E-06
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 411 507 1.0E-06
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 108 505 1.0E-06
sp|O02713|S22A2_PIG Solute carrier family 22 member 2 OS=Sus scrofa GN=SLC22A2 PE=2 SV=1 99 521 1.0E-06
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 424 525 2.0E-06
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 55 376 2.0E-06
sp|Q63089|S22A1_RAT Solute carrier family 22 member 1 OS=Rattus norvegicus GN=Slc22a1 PE=1 SV=1 100 505 2.0E-06
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 99 505 2.0E-06
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 91 288 2.0E-06
sp|Q9R0W2|S22A2_RAT Solute carrier family 22 member 2 OS=Rattus norvegicus GN=Slc22a2 PE=1 SV=1 79 461 2.0E-06
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 411 507 3.0E-06
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 91 288 3.0E-06
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 63 263 3.0E-06
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 58 505 3.0E-06
sp|Q8MJI6|S22A2_RABIT Solute carrier family 22 member 2 OS=Oryctolagus cuniculus GN=SLC22A2 PE=1 SV=1 99 505 3.0E-06
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 91 288 4.0E-06
sp|P76230|YDJK_ECOLI Putative metabolite transport protein YdjK OS=Escherichia coli (strain K12) GN=ydjK PE=3 SV=1 91 508 5.0E-06
sp|A9MNY7|NANT_SALAR Putative sialic acid transporter OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nanT PE=3 SV=1 53 217 6.0E-06
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 88 331 6.0E-06
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 93 445 8.0E-06
sp|B5BGP4|NANT_SALPK Putative sialic acid transporter OS=Salmonella paratyphi A (strain AKU_12601) GN=nanT PE=3 SV=1 53 217 8.0E-06
sp|Q5PLF0|NANT_SALPA Putative sialic acid transporter OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nanT PE=3 SV=1 53 217 8.0E-06
sp|P0A2G5|NANT_SALTY Putative sialic acid transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nanT PE=3 SV=1 53 217 9.0E-06
sp|P0A2G6|NANT_SALTI Putative sialic acid transporter OS=Salmonella typhi GN=nanT PE=3 SV=1 53 217 9.0E-06
sp|A9N832|NANT_SALPB Putative sialic acid transporter OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nanT PE=3 SV=1 53 217 9.0E-06
sp|B4T749|NANT_SALNS Putative sialic acid transporter OS=Salmonella newport (strain SL254) GN=nanT PE=3 SV=1 53 217 9.0E-06
sp|B5RET6|NANT_SALG2 Putative sialic acid transporter OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nanT PE=3 SV=1 53 217 9.0E-06
sp|B5R0L1|NANT_SALEP Putative sialic acid transporter OS=Salmonella enteritidis PT4 (strain P125109) GN=nanT PE=3 SV=1 53 217 9.0E-06
sp|B5FIR7|NANT_SALDC Putative sialic acid transporter OS=Salmonella dublin (strain CT_02021853) GN=nanT PE=3 SV=1 53 217 9.0E-06
sp|B4TJR2|NANT_SALHS Putative sialic acid transporter OS=Salmonella heidelberg (strain SL476) GN=nanT PE=3 SV=1 53 217 9.0E-06
sp|C0PZN3|NANT_SALPC Putative sialic acid transporter OS=Salmonella paratyphi C (strain RKS4594) GN=nanT PE=3 SV=1 53 217 9.0E-06
sp|Q57JD0|NANT_SALCH Putative sialic acid transporter OS=Salmonella choleraesuis (strain SC-B67) GN=nanT PE=3 SV=1 53 217 9.0E-06
sp|B4TWI9|NANT_SALSV Putative sialic acid transporter OS=Salmonella schwarzengrund (strain CVM19633) GN=nanT PE=3 SV=1 53 217 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 101 120 19
3 129 148 19
4 153 175 22
5 188 210 22
6 215 237 22
7 309 331 22
8 346 368 22
9 375 394 19
10 409 431 22
11 443 465 22
12 475 494 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1403
MGAAEEGMEKTELETLEVARPGSGGEVDALIDDMEQQLEAEGGLETGFFRVAFRQPQHFTWLLVAFASMGGLLSG
LDQSLISGANLYLPHDLGLTERENSLVNSGMPLGAVGGALLLSPANEYCGRKGAIIISIVLYTVGAALEAGSINF
AMIVASRVILGVGVGLEGGTVPVYVAETVERRIRGNLVSLYQFNIALGEVLGYAVAAIFLKVPGNWRYILGSSLV
FSTIMFFGMLFLPESPRYLMHMDRRLDAYKVWKRIRGVSSAESRQEFFVMAASVRQEATQVSEGAQNRRFPWMDF
FTVPRARRALVYANIMILLGQLTGVNAIMYYMSVLMHQIGFDAEKANYMSLVGGGSLLIGTIPAIFLMETCGRRF
WAIMMLPGFLIGLVLIGISYQIPIETHTSAVTGLYLTGLVIYMGFFGSYACLTWVIPSEVYPTYLRSYGMTTSDA
LLFLASFVVTYNFTAMQNAMTRTGLTLGFYGGIAVLGEIYQIFFMPETKNKTLEEIDVVLSRPTMDIVRENWAGV
KENMADLAHCRFRKVFVAQTDRQPASDDKVAARA*
Coding >Hirsu2|1403
ATGGGCGCGGCCGAAGAAGGGATGGAAAAGACGGAGCTGGAGACGCTCGAGGTGGCGCGGCCCGGCAGCGGCGGC
GAGGTGGACGCGCTGATCGACGACATGGAGCAGCAGCTCGAGGCCGAGGGCGGGCTCGAGACGGGCTTCTTCCGC
GTCGCCTTCCGGCAGCCGCAGCACTTCACCTGGCTGCTGGTCGCCTTCGCCAGCATGGGCGGCCTGCTGTCCGGG
CTGGACCAGAGCCTCATCTCGGGCGCCAACCTGTACCTGCCGCACGACCTGGGCCTGACGGAGCGGGAGAACAGC
CTGGTCAACTCGGGCATGCCGCTCGGGGCCGTCGGCGGCGCCCTGCTGCTGTCGCCGGCCAACGAGTACTGCGGC
CGCAAGGGGGCCATCATCATCTCCATCGTGCTCTACACCGTCGGCGCCGCCCTCGAGGCCGGCAGCATCAACTTT
GCCATGATCGTGGCATCGCGCGTCATCCTCGGCGTCGGCGTCGGCCTCGAGGGCGGCACGGTCCCCGTCTACGTC
GCCGAGACGGTCGAGCGTCGCATTCGAGGCAACCTCGTCTCGCTCTACCAGTTCAACATCGCGCTGGGCGAGGTG
CTGGGCTATGCCGTCGCCGCCATCTTCCTCAAGGTGCCCGGCAACTGGCGCTACATCCTGGGCTCGTCCCTCGTC
TTTTCCACCATCATGTTCTTTGGCATGCTCTTCCTGCCCGAGAGCCCGCGCTATCTCATGCACATGGACCGCCGG
CTGGACGCGTACAAGGTGTGGAAGCGCATCCGCGGCGTCTCGTCGGCCGAGTCGAGGCAGGAGTTCTTCGTCATG
GCGGCGTCGGTGCGACAGGAGGCGACGCAGGTCAGCGAGGGCGCCCAGAACCGGCGCTTCCCCTGGATGGACTTC
TTCACCGTCCCCCGCGCCCGGCGCGCCCTCGTCTACGCCAACATCATGATCCTGCTGGGCCAGCTGACGGGCGTC
AACGCCATCATGTACTACATGTCGGTGCTGATGCACCAGATCGGCTTCGACGCCGAGAAGGCCAACTACATGTCG
CTCGTCGGCGGCGGCTCGCTCCTCATCGGCACCATCCCGGCCATCTTCCTGATGGAGACGTGCGGCCGGCGCTTC
TGGGCCATCATGATGCTGCCCGGCTTCCTGATCGGCCTGGTCCTGATCGGCATCAGCTACCAGATCCCGATCGAG
ACGCACACGTCGGCCGTCACGGGCCTGTACCTGACGGGCCTCGTCATCTACATGGGCTTCTTTGGCTCGTACGCC
TGCCTGACTTGGGTGATCCCGTCCGAGGTGTACCCAACCTACCTGCGCAGCTACGGCATGACGACGTCGGACGCG
CTGCTGTTCCTGGCCTCGTTCGTCGTCACCTACAACTTCACGGCGATGCAGAACGCCATGACGCGGACGGGGCTG
ACGCTGGGCTTCTACGGCGGCATCGCCGTCCTCGGCGAGATCTACCAGATCTTCTTCATGCCCGAGACCAAGAAC
AAGACGCTCGAGGAGATCGACGTGGTGCTGTCGCGGCCGACCATGGACATTGTGCGCGAGAACTGGGCCGGCGTC
AAGGAGAACATGGCGGACCTGGCCCACTGCCGCTTCCGCAAGGTCTTTGTCGCCCAGACGGACCGGCAGCCGGCT
TCGGACGACAAGGTCGCGGCCCGAGCTTGA
Transcript >Hirsu2|1403
ATGGGCGCGGCCGAAGAAGGGATGGAAAAGACGGAGCTGGAGACGCTCGAGGTGGCGCGGCCCGGCAGCGGCGGC
GAGGTGGACGCGCTGATCGACGACATGGAGCAGCAGCTCGAGGCCGAGGGCGGGCTCGAGACGGGCTTCTTCCGC
GTCGCCTTCCGGCAGCCGCAGCACTTCACCTGGCTGCTGGTCGCCTTCGCCAGCATGGGCGGCCTGCTGTCCGGG
CTGGACCAGAGCCTCATCTCGGGCGCCAACCTGTACCTGCCGCACGACCTGGGCCTGACGGAGCGGGAGAACAGC
CTGGTCAACTCGGGCATGCCGCTCGGGGCCGTCGGCGGCGCCCTGCTGCTGTCGCCGGCCAACGAGTACTGCGGC
CGCAAGGGGGCCATCATCATCTCCATCGTGCTCTACACCGTCGGCGCCGCCCTCGAGGCCGGCAGCATCAACTTT
GCCATGATCGTGGCATCGCGCGTCATCCTCGGCGTCGGCGTCGGCCTCGAGGGCGGCACGGTCCCCGTCTACGTC
GCCGAGACGGTCGAGCGTCGCATTCGAGGCAACCTCGTCTCGCTCTACCAGTTCAACATCGCGCTGGGCGAGGTG
CTGGGCTATGCCGTCGCCGCCATCTTCCTCAAGGTGCCCGGCAACTGGCGCTACATCCTGGGCTCGTCCCTCGTC
TTTTCCACCATCATGTTCTTTGGCATGCTCTTCCTGCCCGAGAGCCCGCGCTATCTCATGCACATGGACCGCCGG
CTGGACGCGTACAAGGTGTGGAAGCGCATCCGCGGCGTCTCGTCGGCCGAGTCGAGGCAGGAGTTCTTCGTCATG
GCGGCGTCGGTGCGACAGGAGGCGACGCAGGTCAGCGAGGGCGCCCAGAACCGGCGCTTCCCCTGGATGGACTTC
TTCACCGTCCCCCGCGCCCGGCGCGCCCTCGTCTACGCCAACATCATGATCCTGCTGGGCCAGCTGACGGGCGTC
AACGCCATCATGTACTACATGTCGGTGCTGATGCACCAGATCGGCTTCGACGCCGAGAAGGCCAACTACATGTCG
CTCGTCGGCGGCGGCTCGCTCCTCATCGGCACCATCCCGGCCATCTTCCTGATGGAGACGTGCGGCCGGCGCTTC
TGGGCCATCATGATGCTGCCCGGCTTCCTGATCGGCCTGGTCCTGATCGGCATCAGCTACCAGATCCCGATCGAG
ACGCACACGTCGGCCGTCACGGGCCTGTACCTGACGGGCCTCGTCATCTACATGGGCTTCTTTGGCTCGTACGCC
TGCCTGACTTGGGTGATCCCGTCCGAGGTGTACCCAACCTACCTGCGCAGCTACGGCATGACGACGTCGGACGCG
CTGCTGTTCCTGGCCTCGTTCGTCGTCACCTACAACTTCACGGCGATGCAGAACGCCATGACGCGGACGGGGCTG
ACGCTGGGCTTCTACGGCGGCATCGCCGTCCTCGGCGAGATCTACCAGATCTTCTTCATGCCCGAGACCAAGAAC
AAGACGCTCGAGGAGATCGACGTGGTGCTGTCGCGGCCGACCATGGACATTGTGCGCGAGAACTGGGCCGGCGTC
AAGGAGAACATGGCGGACCTGGCCCACTGCCGCTTCCGCAAGGTCTTTGTCGCCCAGACGGACCGGCAGCCGGCT
TCGGACGACAAGGTCGCGGCCCGAGCTTGA
Gene >Hirsu2|1403
ATGGGCGCGGCCGAAGAAGGGATGGAAAAGACGGAGCTGGAGACGCTCGAGGTGGCGCGGCCCGGCAGCGGCGGC
GAGGTGGACGCGCTGATCGACGACATGGAGCAGCAGCTCGAGGCCGAGGGCGGGCTCGAGACGGGCTTCTTCCGC
GTCGCCTTCCGGCAGCCGCAGCACTTCACCTGGCTGCTGGTCGCCTTCGCCAGCATGGGCGGCCTGCTGTCCGGG
CTGGACCAGAGCCTCATCTCGGGCGCCAACCTGTACCTGCCGCACGACCTGGGCCTGACGGAGCGGGAGAACAGC
CTGGTCAACTCGGGCATGCCGCTCGGGGCCGTCGGCGGCGCCCTGCTGCTGTCGCCGGCCAACGAGTACTGCGGC
CGCAAGGGGGCCATCATCATCTCCATCGTGCTCTACACCGTCGGCGCCGCCCTCGAGGCCGGCAGCATCAACTTT
GGTGAGTCTCGCTGTCCAGAGACCCGTTCCAGGAGTTTCAACTGTCGGGGCTGTGTCTTCTGACACTGACGAACA
GCCATGATCGTGGCATCGCGCGTCATCCTCGGCGTCGGCGTCGGCCTCGAGGGCGGCACGGTCCCCGTCTACGTC
GCCGAGACGGTCGAGCGTCGCATTCGAGGCAACCTCGTCTCGCTCTACCAGTTCAACATCGCGCTGGGCGAGGTG
CTGGGCTATGCCGTCGCCGCCATCTTCCTCAAGGTGCCCGGCAACTGGCGCTACATCCTGGGCTCGTCCCTCGTC
TTTTCCACCATCATGTTCTTTGGGTAAGGCCGGCCGGGAGAGAGAGAGAGAGAGAAAGAGAGGTCGCCCTCGAGT
CTCGTCGAGCAGAAAGGGCTGCGCTAACGAGAGGACGACGCGTCCGCTTTTTCGTCACAGCATGCTCTTCCTGCC
CGAGAGCCCGCGCTATCTCATGCACATGGACCGCCGGCTGGACGCGTACAAGGTGTGGAAGCGCATCCGCGGCGT
CTCGTCGGCCGAGTCGAGGCAGGAGTTCTTCGTCATGGCGGCGTCGGTGCGACAGGAGGCGACGCAGGTCAGCGA
GGGCGCCCAGAACCGGCGCTTCCCCTGGATGGACTTCTTCACGTACGTGCTGTTCCCCAGCTTTCCCTTTCGGCC
TGGCCGTTCTGACCTCTGCCGGCCCGCACCTCAGCGTCCCCCGCGCCCGGCGCGCCCTCGTCTACGCCAACATCA
TGATCCTGCTGGGCCAGCTGACGGGCGTCAACGCCATCATGTACTACATGTCGGTGCTGATGCACCAGATCGGCT
TCGACGCCGAGAAGGCCAACTACATGTCGCTCGTCGGCGGCGGCTCGCTCCTCATCGGCACCATCCCGGCCATCT
TCCTGATGGAGACGTGCGGCCGGCGCTTCTGGGCCATCATGATGCTGCCCGGCTTCCTGATCGGCCTGGTCCTGA
TCGGCATCAGCTACCAGATCCCGATCGAGACGCACACGTCGGCCGTCACGGGCCTGTACCTGACGGGCCTCGTCA
TCTACATGGGCTTCTTTGGCTCGTACGCCTGCCTGACTTGGGGTGAGTGGACGACACCAGCCACTGACGGACGGG
GGCGAGCAAGGGGGCCGGCAGGAGAGAGATGCACGATGTGTGTGTGCGTGTGTGTTGTCGTCACATCTTGGGAGC
TTGCTGACTCGACCTTTTCCTCTTCCTCTCCCGGCCCGCAGTGATCCCGTCCGAGGTGTACCCAACCTACCTGCG
CAGCTACGGCATGACGACGTCGGACGCGCTGCTGTTCCTGGCCTCGTTCGTCGTCACCTACAACTTCACGGCGAT
GCAGAACGCCATGACGCGGACGGGGCTGACGCTGGGCTTCTACGGCGGCATCGCCGTCCTCGGCGAGATCTACCA
GATCTTCTTCATGCCCGAGACCAAGAACAAGACGCTCGAGGAGATCGACGTGGTGCTGTCGCGGCCGACCATGGA
CATTGTGCGCGAGAACTGGGCCGGCGTCAAGGAGAACATGGCGGACCTGGCCCACTGCCGCTTCCGCAAGGTCTT
TGTCGCCCAGACGGACCGGCAGCCGGCTTCGGACGACAAGGTCGCGGCCCGAGCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail