Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1390
Gene name
LocationContig_130:31228..35367
Strand+
Gene length (bp)4139
Transcript length (bp)3909
Coding sequence length (bp)3909
Protein length (aa) 1303

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08801 Nucleoporin_N Nup133 N terminal like 2.4E-97 133 584
PF03177 Nucleoporin_C Non-repetitive/WGA-negative nucleoporin C-terminal 5.6E-50 817 1243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0S7B6|NU170_CHATD Nucleoporin NUP170 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP170 PE=1 SV=1 4 1288 0.0E+00
sp|Q9URX8|NG06_SCHPO Probable nucleoporin C890.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC890.06 PE=3 SV=3 93 1277 0.0E+00
sp|P38181|NU170_YEAST Nucleoporin NUP170 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP170 PE=1 SV=1 2 1268 7.0E-131
sp|P40064|NU157_YEAST Nucleoporin NUP157 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP157 PE=1 SV=1 105 1265 1.0E-107
sp|O75694|NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens GN=NUP155 PE=1 SV=1 664 1212 6.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0S7B6|NU170_CHATD Nucleoporin NUP170 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP170 PE=1 SV=1 4 1288 0.0E+00
sp|Q9URX8|NG06_SCHPO Probable nucleoporin C890.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC890.06 PE=3 SV=3 93 1277 0.0E+00
sp|P38181|NU170_YEAST Nucleoporin NUP170 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP170 PE=1 SV=1 2 1268 7.0E-131
sp|P40064|NU157_YEAST Nucleoporin NUP157 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP157 PE=1 SV=1 105 1265 1.0E-107
sp|O75694|NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens GN=NUP155 PE=1 SV=1 664 1212 6.0E-44
sp|P37199|NU155_RAT Nuclear pore complex protein Nup155 OS=Rattus norvegicus GN=Nup155 PE=1 SV=1 664 1212 2.0E-42
sp|Q99P88|NU155_MOUSE Nuclear pore complex protein Nup155 OS=Mus musculus GN=Nup155 PE=1 SV=1 664 1212 4.0E-42
sp|O75694|NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens GN=NUP155 PE=1 SV=1 94 668 2.0E-37
sp|Q99P88|NU155_MOUSE Nuclear pore complex protein Nup155 OS=Mus musculus GN=Nup155 PE=1 SV=1 62 668 2.0E-37
sp|P37199|NU155_RAT Nuclear pore complex protein Nup155 OS=Rattus norvegicus GN=Nup155 PE=1 SV=1 94 668 3.0E-35
sp|F4HXV6|NU155_ARATH Nuclear pore complex protein NUP155 OS=Arabidopsis thaliana GN=NUP155 PE=1 SV=1 132 418 3.0E-28
sp|F4HXV6|NU155_ARATH Nuclear pore complex protein NUP155 OS=Arabidopsis thaliana GN=NUP155 PE=1 SV=1 683 1212 2.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1390
MAFPQTPVRPVPGAFLNTPAVASRFQSGPDPLRRQLFPVSEGGQGAAANAGALTSKTPPPSSVAVASAPEAAGLV
AATPLPPPRAENVPPVVKAAKAINAFLQLDESFPDMDSYCRQGASSDYELPGADSPWAPFHKTHMYPIPNQVFDH
YNAGELQTLMGLFAEINHAWVVIDNSLFLWDYTHPDPELIGFEDQPHTIHAVALVPPKPGIFVNTITHILAVATS
ADMILLGLSATDTAAGTKSVALYQTKMNLPLRGTDVRAISGSADGRIFFGGSSDVDINELYYQSEEKWFSNRCGK
INHTNPGWSSVVSLQSGFWSQKVPEHLVDIAIDDTRKLVYTLSSKSTIRTYHMESPDRLNKVIEKEKVHCLRDIA
HMITQSKLLNDRMNIVSISPISKQEASKLHLMALTDTGCRLFFSATSASSYLYGSQSNMAPQSMQVQFIKFPPSP
NPRRSGQPSPSSGQPGSESVVDLDSTMLLSSRKGARFAPGYFLDFVSSADNASADTLFVSGPESGRIKRVSPTAP
LRYFEQASWIDIGSRAEAVGLITRPFAAAPQPLGFGNELAVQFDEPPSEFAVLTNTGIHVIRRRRLVDTFAAAIR
DAPGDEALDTVTRRLIQLYGRVETVSAALAVACGHGGDARPGAARAMDQATEDRARGLFVDFGGQPTMTETDGTA
LTADSVRLSSRHDALALYLSRLIRQLWKAPVIRSGVLPAGGLAIDSAVPLPKLVATQENLERLRKFMESNRGLIQ
GMSGPSDLQRVSSRQEEVALQAEHQALHALQKLMECISEGISFVLMMFDERVADIFTRLDDAARQQLRDLTYEKL
FSQPDGRDLAKLLVKAIVNRNIESGSNVETVADALRRRCGSFCSPDDVVIFKAQEQLKRASEQPANSNVSRGLLH
ESLKLFEKVAGSLTLANLQTAVMQYVELKYYAGAIQLCLAVAREKDRGNTALMWVKDGRPNNDARAGAFNERRRC
YDLIHDALLHLDAASSKEPEIVDGKLTLIATKRLEAYDVVNGSDDEVFHFDLYEWYIHQGWTDRILAIDSPHVVT
FLQHLAATSAEHADLLCRFYTNRSRFFDAAEVQNELARSDFGLGIKDRIRLLSLAKANASVATVGVSRQQQQMLN
HAVGELLEVANIQDDLLGRLRMDERMNPERMAEIEQALDGKVLDLSELFNQYADQAGYYDLCLLIYHTANYRNST
TISGTWTNLIQQTHDEVMSRLDGLEPGMPSPPMPYEAVTSKIQNIAHHTSLDSNVFPIETLLPELCRYAVAYQQD
ATIGAEPTWPVQLTTASAARRATASSS*
Coding >Hirsu2|1390
ATGGCCTTCCCGCAGACGCCCGTGCGGCCGGTGCCGGGCGCGTTCCTCAACACGCCGGCCGTCGCCTCGCGCTTC
CAGTCCGGGCCAGACCCTCTGCGACGACAGCTATTCCCCGTCTCCGAGGGCGGCCAGGGCGCGGCCGCCAATGCC
GGCGCCCTGACGTCCAAGACGCCTCCCCCGTCGTCCGTCGCCGTCGCCAGCGCCCCCGAGGCGGCGGGACTCGTG
GCGGCGACGCCGCTGCCGCCGCCGCGTGCCGAGAACGTGCCTCCGGTCGTCAAGGCGGCCAAGGCCATCAACGCC
TTCTTGCAGCTGGATGAGAGCTTCCCGGACATGGACTCGTACTGCCGCCAGGGCGCCTCGTCCGACTACGAGCTC
CCCGGCGCCGACTCCCCCTGGGCGCCCTTCCACAAGACGCACATGTATCCGATCCCCAACCAGGTCTTCGACCAC
TACAACGCCGGAGAGCTGCAGACGCTCATGGGCCTGTTCGCCGAGATCAACCACGCGTGGGTGGTCATCGACAAC
TCCCTCTTCCTGTGGGACTACACCCACCCCGACCCCGAGCTCATCGGGTTCGAGGACCAGCCGCATACCATCCAC
GCCGTCGCTCTCGTGCCGCCCAAGCCGGGCATCTTCGTCAACACGATAACCCACATCCTCGCCGTCGCCACGTCT
GCCGACATGATCCTGCTCGGCCTGTCGGCCACGGACACGGCGGCCGGCACCAAGTCGGTGGCCCTGTATCAGACC
AAGATGAACCTGCCGCTGCGTGGCACCGACGTGCGCGCCATCTCCGGATCGGCCGACGGCCGCATCTTCTTCGGC
GGCAGCAGCGACGTCGACATCAACGAGCTCTACTACCAGTCCGAGGAGAAGTGGTTCTCGAACCGCTGCGGCAAG
ATCAACCACACCAACCCGGGCTGGTCGTCGGTCGTCTCGCTGCAGTCGGGCTTCTGGTCCCAGAAGGTGCCCGAG
CACCTGGTGGACATTGCCATCGACGACACGCGGAAGCTCGTGTACACCCTCTCGAGCAAGTCGACCATCCGTACC
TATCACATGGAGTCCCCGGACCGCCTCAACAAGGTCATCGAGAAGGAGAAGGTGCACTGTCTCCGCGACATTGCC
CACATGATCACCCAGTCCAAGCTCCTCAACGACCGGATGAACATTGTGTCCATCAGCCCCATCTCCAAGCAGGAG
GCCTCGAAGCTGCACCTCATGGCCCTGACCGACACCGGCTGCCGCCTGTTCTTCAGCGCCACCAGCGCCTCGTCC
TACCTCTACGGCTCGCAGTCCAACATGGCGCCCCAGAGCATGCAGGTCCAGTTCATCAAGTTCCCCCCGAGCCCG
AACCCGCGCCGGTCCGGCCAGCCGTCGCCCTCGTCCGGCCAGCCCGGCAGCGAGTCCGTCGTCGACCTGGACTCG
ACCATGCTGCTGTCCAGCCGGAAGGGCGCCCGCTTCGCGCCGGGCTACTTCCTCGACTTCGTCAGCAGCGCCGAC
AACGCCAGCGCCGACACGCTCTTCGTGTCCGGGCCCGAGTCCGGCCGGATCAAGCGCGTCTCGCCCACCGCGCCC
CTGCGGTACTTTGAGCAGGCCAGCTGGATCGACATCGGGAGCCGGGCCGAGGCCGTCGGCCTCATCACCAGGCCC
TTCGCCGCCGCACCCCAGCCGCTCGGCTTCGGCAACGAGCTGGCGGTGCAGTTCGACGAGCCGCCGAGCGAGTTC
GCCGTCCTCACCAACACGGGCATCCACGTGATCCGACGGCGCAGGCTCGTCGACACCTTCGCCGCCGCAATACGG
GACGCCCCCGGCGACGAGGCCCTCGACACCGTCACGCGCCGCCTGATCCAGCTGTACGGCCGGGTCGAGACCGTC
TCGGCCGCCCTGGCGGTGGCCTGCGGCCACGGCGGAGACGCGCGGCCCGGCGCGGCGAGGGCGATGGACCAGGCG
ACCGAGGACCGGGCCCGGGGGCTCTTCGTCGACTTCGGCGGGCAGCCGACCATGACGGAGACGGACGGGACGGCG
CTGACGGCCGACTCGGTCAGGCTGTCGTCGCGCCACGACGCGCTGGCCCTGTACCTGTCGCGCCTGATCCGCCAG
CTGTGGAAGGCGCCCGTCATCCGGTCGGGTGTCTTGCCCGCGGGGGGCCTGGCCATCGACTCGGCCGTGCCGCTG
CCCAAGCTCGTGGCGACGCAGGAGAACCTCGAGCGGCTGAGGAAGTTCATGGAGTCCAACCGCGGCCTCATCCAG
GGCATGTCCGGGCCGTCGGACCTGCAGCGCGTCTCGAGCCGGCAGGAGGAGGTGGCGCTGCAGGCGGAGCACCAG
GCGCTGCACGCGCTGCAGAAGCTGATGGAGTGCATATCCGAGGGCATCTCGTTCGTGCTCATGATGTTCGACGAG
CGGGTGGCGGACATCTTCACCCGGCTGGACGACGCGGCGCGGCAGCAGCTCCGGGACCTCACCTACGAGAAGCTG
TTCTCGCAACCCGACGGCCGGGACCTGGCTAAGCTGCTGGTCAAGGCCATCGTGAACCGCAACATCGAGAGCGGG
TCCAACGTGGAGACGGTGGCGGACGCGCTGAGGAGGCGGTGCGGCAGCTTCTGCAGCCCGGACGACGTCGTCATC
TTCAAGGCGCAGGAGCAGCTGAAGCGGGCGTCGGAGCAGCCGGCTAACAGCAACGTGTCGCGGGGCCTGCTGCAC
GAGAGCCTGAAGCTGTTCGAGAAGGTGGCCGGCAGCCTGACGCTGGCGAACCTGCAGACGGCCGTGATGCAGTAC
GTCGAGCTCAAGTACTACGCCGGCGCGATCCAGCTCTGCCTCGCGGTCGCGCGCGAGAAGGACCGGGGCAACACG
GCCCTGATGTGGGTCAAGGACGGGCGGCCGAACAACGACGCGCGGGCCGGCGCCTTCAACGAGCGGCGGCGATGC
TACGACCTGATCCACGACGCGCTGCTGCACCTCGACGCCGCGTCGAGCAAGGAGCCCGAGATCGTGGACGGCAAG
CTGACGCTGATTGCGACCAAGCGGCTCGAGGCCTACGACGTGGTCAACGGGTCCGACGACGAGGTCTTCCACTTC
GACCTGTACGAGTGGTACATCCACCAGGGCTGGACGGACCGCATCCTGGCCATCGACTCGCCGCACGTCGTCACC
TTCCTGCAGCACCTGGCCGCCACGAGCGCCGAGCACGCGGACCTGCTGTGCCGCTTCTACACCAACCGGAGCCGC
TTCTTCGACGCGGCCGAGGTGCAGAACGAGCTGGCCCGGTCCGACTTTGGGCTCGGCATCAAGGACCGCATCAGG
CTGCTGAGCCTGGCCAAGGCCAACGCCAGCGTGGCGACGGTGGGCGTCAGCCGGCAGCAGCAGCAGATGCTGAAC
CACGCCGTCGGCGAGCTGCTCGAGGTCGCCAACATCCAGGACGACCTCCTGGGCCGCCTGAGGATGGACGAGAGG
ATGAACCCGGAGAGGATGGCGGAGATTGAACAAGCCCTGGACGGAAAGGTCCTGGATCTGTCCGAACTCTTCAAC
CAATATGCCGACCAGGCCGGCTACTACGACCTGTGCCTGCTCATCTACCACACGGCCAACTACCGCAACTCGACA
ACCATCTCCGGGACGTGGACCAACTTGATCCAGCAGACGCACGACGAGGTCATGTCTCGACTGGACGGCCTGGAG
CCGGGCATGCCGTCGCCGCCGATGCCGTACGAGGCGGTGACGAGCAAGATCCAGAACATTGCGCACCACACGTCG
CTCGACAGCAACGTGTTCCCGATCGAGACGCTGCTCCCGGAGCTGTGCCGGTACGCGGTGGCTTACCAACAGGAC
GCGACGATCGGGGCGGAGCCGACGTGGCCGGTGCAGCTGACTACGGCTTCAGCGGCACGACGCGCAACCGCGTCA
TCGAGCTGA
Transcript >Hirsu2|1390
ATGGCCTTCCCGCAGACGCCCGTGCGGCCGGTGCCGGGCGCGTTCCTCAACACGCCGGCCGTCGCCTCGCGCTTC
CAGTCCGGGCCAGACCCTCTGCGACGACAGCTATTCCCCGTCTCCGAGGGCGGCCAGGGCGCGGCCGCCAATGCC
GGCGCCCTGACGTCCAAGACGCCTCCCCCGTCGTCCGTCGCCGTCGCCAGCGCCCCCGAGGCGGCGGGACTCGTG
GCGGCGACGCCGCTGCCGCCGCCGCGTGCCGAGAACGTGCCTCCGGTCGTCAAGGCGGCCAAGGCCATCAACGCC
TTCTTGCAGCTGGATGAGAGCTTCCCGGACATGGACTCGTACTGCCGCCAGGGCGCCTCGTCCGACTACGAGCTC
CCCGGCGCCGACTCCCCCTGGGCGCCCTTCCACAAGACGCACATGTATCCGATCCCCAACCAGGTCTTCGACCAC
TACAACGCCGGAGAGCTGCAGACGCTCATGGGCCTGTTCGCCGAGATCAACCACGCGTGGGTGGTCATCGACAAC
TCCCTCTTCCTGTGGGACTACACCCACCCCGACCCCGAGCTCATCGGGTTCGAGGACCAGCCGCATACCATCCAC
GCCGTCGCTCTCGTGCCGCCCAAGCCGGGCATCTTCGTCAACACGATAACCCACATCCTCGCCGTCGCCACGTCT
GCCGACATGATCCTGCTCGGCCTGTCGGCCACGGACACGGCGGCCGGCACCAAGTCGGTGGCCCTGTATCAGACC
AAGATGAACCTGCCGCTGCGTGGCACCGACGTGCGCGCCATCTCCGGATCGGCCGACGGCCGCATCTTCTTCGGC
GGCAGCAGCGACGTCGACATCAACGAGCTCTACTACCAGTCCGAGGAGAAGTGGTTCTCGAACCGCTGCGGCAAG
ATCAACCACACCAACCCGGGCTGGTCGTCGGTCGTCTCGCTGCAGTCGGGCTTCTGGTCCCAGAAGGTGCCCGAG
CACCTGGTGGACATTGCCATCGACGACACGCGGAAGCTCGTGTACACCCTCTCGAGCAAGTCGACCATCCGTACC
TATCACATGGAGTCCCCGGACCGCCTCAACAAGGTCATCGAGAAGGAGAAGGTGCACTGTCTCCGCGACATTGCC
CACATGATCACCCAGTCCAAGCTCCTCAACGACCGGATGAACATTGTGTCCATCAGCCCCATCTCCAAGCAGGAG
GCCTCGAAGCTGCACCTCATGGCCCTGACCGACACCGGCTGCCGCCTGTTCTTCAGCGCCACCAGCGCCTCGTCC
TACCTCTACGGCTCGCAGTCCAACATGGCGCCCCAGAGCATGCAGGTCCAGTTCATCAAGTTCCCCCCGAGCCCG
AACCCGCGCCGGTCCGGCCAGCCGTCGCCCTCGTCCGGCCAGCCCGGCAGCGAGTCCGTCGTCGACCTGGACTCG
ACCATGCTGCTGTCCAGCCGGAAGGGCGCCCGCTTCGCGCCGGGCTACTTCCTCGACTTCGTCAGCAGCGCCGAC
AACGCCAGCGCCGACACGCTCTTCGTGTCCGGGCCCGAGTCCGGCCGGATCAAGCGCGTCTCGCCCACCGCGCCC
CTGCGGTACTTTGAGCAGGCCAGCTGGATCGACATCGGGAGCCGGGCCGAGGCCGTCGGCCTCATCACCAGGCCC
TTCGCCGCCGCACCCCAGCCGCTCGGCTTCGGCAACGAGCTGGCGGTGCAGTTCGACGAGCCGCCGAGCGAGTTC
GCCGTCCTCACCAACACGGGCATCCACGTGATCCGACGGCGCAGGCTCGTCGACACCTTCGCCGCCGCAATACGG
GACGCCCCCGGCGACGAGGCCCTCGACACCGTCACGCGCCGCCTGATCCAGCTGTACGGCCGGGTCGAGACCGTC
TCGGCCGCCCTGGCGGTGGCCTGCGGCCACGGCGGAGACGCGCGGCCCGGCGCGGCGAGGGCGATGGACCAGGCG
ACCGAGGACCGGGCCCGGGGGCTCTTCGTCGACTTCGGCGGGCAGCCGACCATGACGGAGACGGACGGGACGGCG
CTGACGGCCGACTCGGTCAGGCTGTCGTCGCGCCACGACGCGCTGGCCCTGTACCTGTCGCGCCTGATCCGCCAG
CTGTGGAAGGCGCCCGTCATCCGGTCGGGTGTCTTGCCCGCGGGGGGCCTGGCCATCGACTCGGCCGTGCCGCTG
CCCAAGCTCGTGGCGACGCAGGAGAACCTCGAGCGGCTGAGGAAGTTCATGGAGTCCAACCGCGGCCTCATCCAG
GGCATGTCCGGGCCGTCGGACCTGCAGCGCGTCTCGAGCCGGCAGGAGGAGGTGGCGCTGCAGGCGGAGCACCAG
GCGCTGCACGCGCTGCAGAAGCTGATGGAGTGCATATCCGAGGGCATCTCGTTCGTGCTCATGATGTTCGACGAG
CGGGTGGCGGACATCTTCACCCGGCTGGACGACGCGGCGCGGCAGCAGCTCCGGGACCTCACCTACGAGAAGCTG
TTCTCGCAACCCGACGGCCGGGACCTGGCTAAGCTGCTGGTCAAGGCCATCGTGAACCGCAACATCGAGAGCGGG
TCCAACGTGGAGACGGTGGCGGACGCGCTGAGGAGGCGGTGCGGCAGCTTCTGCAGCCCGGACGACGTCGTCATC
TTCAAGGCGCAGGAGCAGCTGAAGCGGGCGTCGGAGCAGCCGGCTAACAGCAACGTGTCGCGGGGCCTGCTGCAC
GAGAGCCTGAAGCTGTTCGAGAAGGTGGCCGGCAGCCTGACGCTGGCGAACCTGCAGACGGCCGTGATGCAGTAC
GTCGAGCTCAAGTACTACGCCGGCGCGATCCAGCTCTGCCTCGCGGTCGCGCGCGAGAAGGACCGGGGCAACACG
GCCCTGATGTGGGTCAAGGACGGGCGGCCGAACAACGACGCGCGGGCCGGCGCCTTCAACGAGCGGCGGCGATGC
TACGACCTGATCCACGACGCGCTGCTGCACCTCGACGCCGCGTCGAGCAAGGAGCCCGAGATCGTGGACGGCAAG
CTGACGCTGATTGCGACCAAGCGGCTCGAGGCCTACGACGTGGTCAACGGGTCCGACGACGAGGTCTTCCACTTC
GACCTGTACGAGTGGTACATCCACCAGGGCTGGACGGACCGCATCCTGGCCATCGACTCGCCGCACGTCGTCACC
TTCCTGCAGCACCTGGCCGCCACGAGCGCCGAGCACGCGGACCTGCTGTGCCGCTTCTACACCAACCGGAGCCGC
TTCTTCGACGCGGCCGAGGTGCAGAACGAGCTGGCCCGGTCCGACTTTGGGCTCGGCATCAAGGACCGCATCAGG
CTGCTGAGCCTGGCCAAGGCCAACGCCAGCGTGGCGACGGTGGGCGTCAGCCGGCAGCAGCAGCAGATGCTGAAC
CACGCCGTCGGCGAGCTGCTCGAGGTCGCCAACATCCAGGACGACCTCCTGGGCCGCCTGAGGATGGACGAGAGG
ATGAACCCGGAGAGGATGGCGGAGATTGAACAAGCCCTGGACGGAAAGGTCCTGGATCTGTCCGAACTCTTCAAC
CAATATGCCGACCAGGCCGGCTACTACGACCTGTGCCTGCTCATCTACCACACGGCCAACTACCGCAACTCGACA
ACCATCTCCGGGACGTGGACCAACTTGATCCAGCAGACGCACGACGAGGTCATGTCTCGACTGGACGGCCTGGAG
CCGGGCATGCCGTCGCCGCCGATGCCGTACGAGGCGGTGACGAGCAAGATCCAGAACATTGCGCACCACACGTCG
CTCGACAGCAACGTGTTCCCGATCGAGACGCTGCTCCCGGAGCTGTGCCGGTACGCGGTGGCTTACCAACAGGAC
GCGACGATCGGGGCGGAGCCGACGTGGCCGGTGCAGCTGACTACGGCTTCAGCGGCACGACGCGCAACCGCGTCA
TCGAGCTGA
Gene >Hirsu2|1390
ATGGCCTTCCCGCAGACGCCCGTGCGGCCGGTGCCGGGCGCGTTCCTCAACACGCCGGCCGTCGCCTCGCGCTTC
CAGTCCGGGCCAGACCCTCTGCGACGACAGCTATTCCCCGTCTCCGAGGGCGGCCAGGGCGCGGCCGCCAATGCC
GGCGCCCTGACGTCCAAGACGCCTCCCCCGTCGTCCGTCGCCGTCGCCAGCGCCCCCGAGGCGGCGGGACTCGTG
GCGGCGACGCCGCTGCCGCCGCCGCGTGCCGAGAACGTGCCTCCGGTCGTCAAGGCGGCCAAGGCCATCAACGCC
TTCTTGCAGCTGGATGAGAGCTTCCCGGACATGGACTCGTACTGCCGCCGTACGCCCCCCCCCCTCTGAACTTGG
ACGCCCTCCCCGTCTTGGCCGCTGCTGACATTGCTACCAGAGGGCGCCTCGTCCGACTACGAGCTCCCCGGCGCC
GACTCCCCCTGGGCGCCCTTCCACAAGACGCACATGTATCCGATCCCCAACCAGGTCTTCGACCACTACAACGCC
GGAGAGCTGCAGACGCTCATGGGCCTGTTCGCCGAGATCAACCACGCGTGGGTGGTCATCGACAACTCCCTCTTC
CTGTGGGACTACACCCACCCCGACCCCGAGCTCATCGGGTTCGAGGACCAGCCGCATACCATCCACGCCGTCGCT
CTCGTGCCGCCCAAGCCGGGCATCTTCGTCAACACGATAACCCACATCCTCGCCGTCGCCACGTCTGCCGACATG
ATCCTGCTCGGCCTGTCGGCCACGGACACGGCGGCCGGCACCAAGTCGGTGGCCCTGTATCAGACCAAGATGAAC
CTGCCGCTGCGTGGCACCGACGTGCGCGCCATCTCCGGATCGGCCGACGGCCGCATCTTCTTCGGCGGCAGCAGC
GACGTCGACATCAACGAGCTCTACTACCAGTCCGAGGAGAAGTGGTTCTCGAACCGCTGCGGCAAGATCAACCAC
ACCAACCCGGGCTGGTCGTCGGTCGTCTCGCTGCAGTCGGGCTTCTGGTCCCAGAAGGTGCCCGAGCACCTGGTG
GACATTGCCATCGACGACACGCGGAAGCTCGTGTACACCCTCTCGAGCAAGTCGACCATCCGTACCTATCACATG
GAGTCCCCGGACCGCCTCAACAAGGTCATCGAGAAGGAGAAGGTGCACTGTCTCCGCGACATTGCCCACATGATC
ACCCAGTCCAAGCTCCTCAACGACCGGATGAACATTGTGTCCATCAGCCCCATCTCCAAGCAGGAGGCCTCGAAG
CTGCACCTCATGGCCCTGACCGACACCGGCTGCCGCCTGTTCTTCAGCGCCACCAGCGCCTCGTCCTACCTCTAC
GGCTCGCAGTCCAACATGGCGCCCCAGAGCATGCAGGTCCAGTTCATCAAGTTCCCCCCGAGCCCGAACCCGCGC
CGGTCCGGCCAGCCGTCGCCCTCGTCCGGCCAGCCCGGCAGCGAGTCCGTCGTCGACCTGGACTCGACCATGCTG
CTGTCCAGCCGGAAGGGCGCCCGCTTCGCGCCGGGCTACTTCCTCGACTTCGTCAGCAGCGCCGACAACGCCAGC
GCCGACACGCTCTTCGTGTCCGGGCCCGAGTCCGGCCGGATCAAGCGCGTCTCGCCCACCGCGCCCCTGCGGTAC
TTTGAGCAGGCCAGCTGGATCGACATCGGGAGCCGGGCCGAGGCCGTCGGCCTCATCACCAGGCCCTTCGCCGCC
GCACCCCAGCCGCTCGGCTTCGGCAACGAGCTGGCGGTGCAGTTCGACGAGCCGCCGAGCGAGTTCGCCGTCCTC
ACCAACACGGGCATCCACGTGATCCGACGGCGCAGGCTCGTCGACACCTTCGCCGCCGCAATACGGGACGCCCCC
GGCGACGAGGCCCTCGACACCGTCACGCGCCGCCTGATCCAGCTGTACGGCCGGGTCGAGACCGTCTCGGCCGCC
CTGGCGGTGGCCTGCGGCCACGGCGGAGACGCGCGGCCCGGCGCGGCGAGGGCGATGGACCAGGCGACCGAGGAC
CGGGCCCGGGGGCTCTTCGTCGACTTCGGCGGGCAGCCGACCATGACGGAGACGGACGGGACGGCGCTGACGGCC
GACTCGGTCAGGCTGTCGTCGCGCCACGACGCGCTGGCCCTGTACCTGTCGCGCCTGATCCGCCAGCTGTGGAAG
GCGCCCGTCATCCGGTCGGGTGTCTTGCCCGCGGGGGGCCTGGCCATCGACTCGGCCGTGCCGCTGCCCAAGCTC
GTGGCGACGCAGGAGAACCTCGAGCGGCTGAGGAAGTTCATGGAGTCCAACCGCGGCCTCATCCAGGGCATGTCC
GGGCCGTCGGACCTGCAGCGCGTCTCGAGCCGGCAGGAGGAGGTGGCGCTGCAGGCGGAGCACCAGGCGCTGCAC
GCGCTGCAGAAGCTGATGGAGTGCATATCCGAGGGCATCTCGTTCGTGCTCATGATGTTCGACGAGCGGGTGGCG
GACATCTTCACCCGGCTGGACGACGCGGCGCGGCAGCAGCTCCGGGACCTCACCTACGAGAAGCTGTTCTCGCAA
CCCGACGGCCGGGACCTGGCTAAGCTGCTGGTCAAGGCCATCGTGAACCGCAACATCGAGAGCGGGTCCAACGTG
GAGACGGTGGCGGACGCGCTGAGGAGGCGGTGCGGCAGCTTCTGCAGCCCGGACGACGTCGTCATCTTCAAGGCG
CAGGAGCAGCTGAAGCGGGCGTCGGAGCAGCCGGCTAACAGCAACGTGTCGCGGGGCCTGCTGCACGAGAGCCTG
AAGCTGTTCGAGAAGGTGGCCGGCAGCCTGACGCTGGCGAACCTGCAGACGGCCGTGATGCAGTACGTCGAGCTC
AAGTACTACGCCGGCGCGATCCAGCTCTGCCTCGCGGTCGCGCGCGAGAAGGACCGGGGCAACACGGCCCTGATG
TGGGTCAAGGACGGGCGGCCGAACAACGACGCGCGGGCCGGCGCCTTCAACGAGCGGCGGCGATGCTACGACCTG
ATCCACGACGCGCTGCTGCACCTCGACGCCGCGTCGAGCAAGGAGCCCGAGATCGTGGACGGCAAGCTGACGCTG
ATTGCGACCAAGCGGCTCGAGGCCTACGACGTGGTCAACGGGTCCGACGACGAGGTCTTCCACTTCGACCTGTAC
GAGTGGTACATCCACCAGGGCTGGACGGACCGCATCCTGGCCATCGACTCGCCGCACGTCGTCACCTTCCTGCAG
CACCTGGCCGCCACGAGCGCCGAGCACGCGGACCTGCTGTGCCGCTTCTACACCAACCGGAGCCGCTTCTTCGAC
GCGGCCGAGGTGCAGAACGAGCTGGCCCGGTCCGACTTTGGGCTCGGCATCAAGGACCGCATCAGGCTGCTGAGC
CTGGCCAAGGCCAACGCCAGCGTGGCGACGGTGGGCGTCAGCCGGCAGCAGCAGCAGATGCTGAACCACGCCGTC
GGCGAGCTGCTCGAGGTCGCCAACATCCAGGACGACCTCCTGGGCCGCCTGAGGATGGACGAGAGGATGAACCCG
GAGAGGATGGCGGAGATTGAACAAGCCCTGGACGGAAAGGTCCTGGATCTGTCCGAAGTGAGCGCCCCCTCCCCT
CCCTCCCTCTTCGATGCCCGATGTTTTTTTTTTTTTTTCCTTCCTTGTTTTCGTATCCCAGTGATTCACATGGCG
GCAGCTCTTCAACCAATATGCCGACCAGGCCGGCTACTACGACCTGTGCCTGCTCATCTACCACACGGCCAACTA
CCGCAACTCGACAACCATCTCCGGGACGTGGACCAACTTGATCCAGCAGACGCACGACGAGGTCATGTCTCGACT
GGACGGCCTGGAGCCGGGCATGCCGTCGCCGCCGATGCCGTACGAGGCGGTGACGAGCAAGATCCAGAACATTGC
GCACCACACGTCGCTCGACAGCAACGTGTTCCCGATCGAGACGCTGCTCCCGGAGCTGTGCCGGTACGCGGTGGC
TTACCAACAGGACGCGACGATCGGGGCGGAGCCGACGTGGCCGGTGCAGCTGTTCCTGGCGCTGGGCGTGTCGCA
CGACATGATCGTGAGGGTGCTGGAGAACATCTTCGACACGCAGGACTACGGCTTCAGCGGCACGACGCGCAACCG
CGTCATCGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail