Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|139
Gene name
LocationContig_1021:62..911
Strand+
Gene length (bp)849
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 9.8E-21 3 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 1 274 8.0E-40
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 1 266 1.0E-37
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 3 278 8.0E-37
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 1 275 1.0E-36
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 1 266 1.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 1 274 8.0E-40
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 1 266 1.0E-37
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 3 278 8.0E-37
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 1 275 1.0E-36
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 1 266 1.0E-36
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 1 266 2.0E-35
sp|Q9M2P2|MTPC3_ARATH Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2 1 275 7.0E-34
sp|O80632|MTP11_ARATH Metal tolerance protein 11 OS=Arabidopsis thaliana GN=MTP11 PE=2 SV=1 1 274 4.0E-29
sp|Q0DHJ5|MTP6_ORYSJ Metal tolerance protein 6 OS=Oryza sativa subsp. japonica GN=MTP6 PE=2 SV=2 1 277 5.0E-21
[Show less]

GO

GO Term Description Terminal node
GO:0008324 cation transmembrane transporter activity Yes
GO:0006812 cation transport Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006811 ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 62 79 17
3 94 116 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|139
LAGKGVAAFTTGSLSLVASLVDSALDLLCTLIVWTTTRLVLWRLGALRKRFPVGRRRLEPLGILVFSVIMIISFL
QILQESVSRLMPGHGQAEPLSLGAVLALAATIVVKGAIGLACRPVRTAQVQALVQDCKTDVIFNSLSLLFPLVGY
RADVWWLDPAGAGLLSLFIVYDWGRTSFENVVRLSGEAADERTVRKLTYMAYRFSPVVEGFKSITAYHAGDGVWA
EFDILLDENTRLNRSHDIAETLQYCAEGLAGIDRAFVTTDYAAVGPTGHTHDVDWNH*
Coding >Hirsu2|139
CTGGCCGGCAAGGGCGTCGCGGCCTTCACGACGGGGTCGCTGTCGCTCGTCGCCTCGCTCGTCGACTCGGCCCTG
GACCTGCTCTGCACGCTCATCGTGTGGACGACGACGCGGCTCGTGCTGTGGCGGCTGGGCGCGCTGCGCAAGCGC
TTTCCCGTCGGCCGGCGCCGGCTCGAGCCGCTCGGCATCCTCGTCTTCTCCGTCATCATGATCATCTCCTTCCTG
CAGATCCTGCAGGAGTCCGTCTCGCGCCTGATGCCGGGCCACGGCCAGGCCGAGCCGCTCAGCCTGGGCGCCGTC
CTGGCCCTGGCGGCCACCATCGTCGTCAAGGGCGCCATCGGCCTCGCGTGCCGGCCCGTCCGCACGGCCCAGGTG
CAGGCGCTGGTGCAGGACTGCAAGACGGACGTCATCTTCAACTCGCTCTCGCTGCTGTTCCCCCTCGTCGGCTAC
CGCGCCGACGTCTGGTGGCTGGACCCGGCCGGCGCCGGTCTGCTCTCGCTCTTCATCGTCTACGACTGGGGCCGC
ACCTCGTTCGAGAACGTGGTCCGGCTGTCGGGCGAGGCGGCCGACGAGAGGACGGTGCGGAAGCTGACGTACATG
GCCTACCGCTTCTCGCCCGTCGTCGAGGGCTTCAAGTCCATCACCGCCTACCACGCCGGCGACGGCGTCTGGGCC
GAGTTCGACATCCTGCTCGACGAGAACACGAGGCTGAACCGGTCCCACGACATCGCCGAGACGCTGCAGTACTGC
GCCGAGGGCCTGGCCGGCATCGACCGCGCCTTCGTCACGACTGACTACGCCGCCGTCGGCCCGACCGGCCACACC
CACGATGTCGACTGGAATCACTGA
Transcript >Hirsu2|139
CTGGCCGGCAAGGGCGTCGCGGCCTTCACGACGGGGTCGCTGTCGCTCGTCGCCTCGCTCGTCGACTCGGCCCTG
GACCTGCTCTGCACGCTCATCGTGTGGACGACGACGCGGCTCGTGCTGTGGCGGCTGGGCGCGCTGCGCAAGCGC
TTTCCCGTCGGCCGGCGCCGGCTCGAGCCGCTCGGCATCCTCGTCTTCTCCGTCATCATGATCATCTCCTTCCTG
CAGATCCTGCAGGAGTCCGTCTCGCGCCTGATGCCGGGCCACGGCCAGGCCGAGCCGCTCAGCCTGGGCGCCGTC
CTGGCCCTGGCGGCCACCATCGTCGTCAAGGGCGCCATCGGCCTCGCGTGCCGGCCCGTCCGCACGGCCCAGGTG
CAGGCGCTGGTGCAGGACTGCAAGACGGACGTCATCTTCAACTCGCTCTCGCTGCTGTTCCCCCTCGTCGGCTAC
CGCGCCGACGTCTGGTGGCTGGACCCGGCCGGCGCCGGTCTGCTCTCGCTCTTCATCGTCTACGACTGGGGCCGC
ACCTCGTTCGAGAACGTGGTCCGGCTGTCGGGCGAGGCGGCCGACGAGAGGACGGTGCGGAAGCTGACGTACATG
GCCTACCGCTTCTCGCCCGTCGTCGAGGGCTTCAAGTCCATCACCGCCTACCACGCCGGCGACGGCGTCTGGGCC
GAGTTCGACATCCTGCTCGACGAGAACACGAGGCTGAACCGGTCCCACGACATCGCCGAGACGCTGCAGTACTGC
GCCGAGGGCCTGGCCGGCATCGACCGCGCCTTCGTCACGACTGACTACGCCGCCGTCGGCCCGACCGGCCACACC
CACGATGTCGACTGGAATCACTGA
Gene >Hirsu2|139
CTGGCCGGCAAGGGCGTCGCGGCCTTCACGACGGGGTCGCTGTCGCTCGTCGCCTCGCTCGTCGACTCGGCCCTG
GACCTGCTCTGCACGCTCATCGTGTGGACGACGACGCGGCTCGTGCTGTGGCGGCTGGGCGCGCTGCGCAAGCGC
TTTCCCGTCGGCCGGCGCCGGCTCGAGCCGCTCGGCATCCTCGTCTTCTCCGTCATCATGATCATCTCCTTCCTG
CAGATCCTGCAGGAGTCCGTCTCGCGCCTGATGCCGGGCCACGGCCAGGCCGAGCCGCTCAGCCTGGGCGCCGTC
CTGGCCCTGGCGGCCACCATCGTCGTCAAGGGCGCCATCGGCCTCGCGTGCCGGCCCGTCCGCACGGCCCAGGTG
CAGGCGCTGGTGCAGGACTGCAAGACGGACGTCATCTTCAACTCGCTCTCGCTGCTGTTCCCCCTCGTCGGCTAC
CGCGCCGACGTCTGGTGGCTGGACCCGGCCGGCGCCGGTCTGCTCTCGCTCTTCATCGTCTACGACTGGGGCCGC
ACCTCGTTCGAGAACGTGGTCCGGCTGTCGGGCGAGGCGGCCGACGAGAGGACGGTGCGGAAGCTGACGTACATG
GCCTACCGCTTCTCGCCCGTCGTCGAGGGCTTCAAGTCCATCACCGCCTACCACGCCGGCGACGGCGTCTGGGCC
GAGTTCGACATCCTGCTCGACGAGAACACGAGGCTGAACCGGTCCCACGACATCGCCGAGACGCTGCAGTACTGC
GCCGAGGGCCTGGCCGGCATCGACCGCGCCTTCGTCACGACTGACTACGCCGCCGTCGGCCCGACCGGCCACACC
CACGATGTCGACTGGAATCACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail