Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1386
Gene name
LocationContig_130:23186..24993
Strand+
Gene length (bp)1807
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19287 DUF5910 Family of unknown function (DUF5910) 1.9E-21 62 167

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1876 0.0823 0.9163 0.1345 0.044 0.018 0.2517 0.1159 0.2773 0.0014

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999633

Transmembrane Domains

Domain # Start End Length
1 5 23 18

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7494
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|6506
Ophiocordyceps subramaniannii Hirsu2|1386 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1386
MVCRVLSLLFALATIAGVIGAPVKAGRAVIGYRRVNPEQAKRYSDAGTITDDPTGNGGEQIGHGVYTSAITAEKD
VWDKLPKTWIPRSEWWKNDDVDAYIKTVDSSLKPEDTVRLALIDKIPEEQLQMLLPKALLKNQDLRIETKCGNDI
QDSPPVDYGTWGNIKGNRFTRSETKAREVIQEILDSVVKIKAANEKVKDAKTPEEIETLSKEAKENLDKAKESTE
KLAKVIEGARGVKELAVAEGAKQACKDCTMDHKTYQNGFSAYREARREHASFVVKSAERGLSLVAGPGSGAENTG
SAKALKDLAARVEKEVESKRRNKQLIKDELDEYEKQTKERLNSKDIGKVPPNPPESGAENIFVTVSGRVRALNDE
LGVLENELAILDGEDGVLRKLCKGPNSGCKAQSNPETDEDEPPRFYGNKKKGTSSMADKEQDDDDDEPPIFDPKN
KKAASSRADEETGRDGDDESEAGRKKKKASSNGSDEEEDEDDPPDFDVGSGGGQPTADNPDNSDEDSDGRRKAKK
KGSGKTRTRVDSGN*
Coding >Hirsu2|1386
ATGGTTTGCAGGGTTCTTTCGTTGCTCTTTGCTCTTGCTACCATTGCAGGGGTAATCGGCGCCCCTGTCAAGGCC
GGACGTGCAGTCATCGGCTACAGACGCGTGAATCCGGAACAAGCCAAGAGATACAGCGATGCTGGCACCATCACT
GATGATCCCACGGGAAATGGCGGCGAGCAGATCGGCCATGGCGTTTACACCTCGGCCATAACGGCCGAGAAGGAC
GTCTGGGACAAGCTGCCCAAAACGTGGATTCCCCGGAGCGAGTGGTGGAAGAACGATGACGTTGACGCGTACATC
AAAACGGTCGACAGCAGCTTGAAACCAGAAGATACTGTGCGCTTGGCCTTGATTGACAAGATCCCAGAGGAACAG
CTTCAGATGCTCCTCCCCAAGGCTTTACTCAAGAATCAAGACCTACGGATAGAAACCAAGTGTGGAAACGACATT
CAAGACTCGCCGCCCGTCGACTACGGCACCTGGGGCAACATCAAGGGCAACAGGTTCACCCGATCGGAGACAAAA
GCAAGGGAGGTGATTCAAGAAATCCTGGACTCGGTGGTGAAGATCAAGGCGGCCAACGAAAAGGTCAAGGACGCC
AAAACACCGGAGGAGATCGAAACTCTAAGCAAAGAGGCCAAGGAGAATCTCGACAAGGCCAAAGAATCGACAGAG
AAGCTGGCCAAGGTCATAGAAGGCGCGAGGGGTGTGAAAGAGCTCGCAGTCGCCGAGGGGGCAAAGCAGGCCTGC
AAAGACTGCACCATGGACCACAAGACTTACCAGAACGGTTTCAGCGCATATAGAGAGGCCAGAAGGGAGCACGCC
TCATTCGTCGTGAAAAGCGCCGAGAGGGGTCTGAGCCTGGTCGCGGGCCCAGGTTCGGGCGCCGAGAATACAGGC
TCGGCCAAAGCTTTGAAGGATCTGGCTGCTAGAGTGGAGAAGGAAGTCGAGTCGAAAAGGCGGAATAAGCAGCTC
ATCAAAGACGAACTCGACGAATATGAAAAACAGACGAAAGAAAGGCTGAACAGTAAGGATATAGGCAAGGTGCCT
CCAAACCCGCCCGAGTCGGGAGCAGAAAACATCTTCGTCACGGTCTCTGGCCGAGTCCGGGCCCTGAACGACGAG
TTGGGGGTGCTTGAAAACGAATTGGCCATTCTGGATGGTGAAGACGGCGTGCTGAGGAAGTTGTGCAAGGGGCCC
AACTCTGGGTGCAAGGCGCAAAGTAACCCCGAGACTGACGAGGACGAGCCACCGCGTTTCTATGGGAACAAAAAG
AAGGGGACCTCGAGTATGGCCGACAAAGAGCAAGACGACGACGACGACGAACCACCGATATTCGACCCGAAGAAC
AAGAAAGCGGCGTCGAGTAGGGCCGATGAAGAGACCGGGAGGGACGGCGACGACGAGTCGGAGGCCGGCCGAAAG
AAAAAGAAAGCGAGCTCGAATGGGTCCGATGAGGAAGAAGACGAGGACGATCCACCCGACTTTGATGTTGGTAGC
GGGGGAGGCCAGCCGACTGCGGACAACCCAGACAACTCCGACGAAGACTCGGATGGTCGAAGGAAAGCAAAGAAG
AAGGGCTCCGGCAAGACACGGACGAGGGTGGATTCAGGAAACTAG
Transcript >Hirsu2|1386
ATGGTTTGCAGGGTTCTTTCGTTGCTCTTTGCTCTTGCTACCATTGCAGGGGTAATCGGCGCCCCTGTCAAGGCC
GGACGTGCAGTCATCGGCTACAGACGCGTGAATCCGGAACAAGCCAAGAGATACAGCGATGCTGGCACCATCACT
GATGATCCCACGGGAAATGGCGGCGAGCAGATCGGCCATGGCGTTTACACCTCGGCCATAACGGCCGAGAAGGAC
GTCTGGGACAAGCTGCCCAAAACGTGGATTCCCCGGAGCGAGTGGTGGAAGAACGATGACGTTGACGCGTACATC
AAAACGGTCGACAGCAGCTTGAAACCAGAAGATACTGTGCGCTTGGCCTTGATTGACAAGATCCCAGAGGAACAG
CTTCAGATGCTCCTCCCCAAGGCTTTACTCAAGAATCAAGACCTACGGATAGAAACCAAGTGTGGAAACGACATT
CAAGACTCGCCGCCCGTCGACTACGGCACCTGGGGCAACATCAAGGGCAACAGGTTCACCCGATCGGAGACAAAA
GCAAGGGAGGTGATTCAAGAAATCCTGGACTCGGTGGTGAAGATCAAGGCGGCCAACGAAAAGGTCAAGGACGCC
AAAACACCGGAGGAGATCGAAACTCTAAGCAAAGAGGCCAAGGAGAATCTCGACAAGGCCAAAGAATCGACAGAG
AAGCTGGCCAAGGTCATAGAAGGCGCGAGGGGTGTGAAAGAGCTCGCAGTCGCCGAGGGGGCAAAGCAGGCCTGC
AAAGACTGCACCATGGACCACAAGACTTACCAGAACGGTTTCAGCGCATATAGAGAGGCCAGAAGGGAGCACGCC
TCATTCGTCGTGAAAAGCGCCGAGAGGGGTCTGAGCCTGGTCGCGGGCCCAGGTTCGGGCGCCGAGAATACAGGC
TCGGCCAAAGCTTTGAAGGATCTGGCTGCTAGAGTGGAGAAGGAAGTCGAGTCGAAAAGGCGGAATAAGCAGCTC
ATCAAAGACGAACTCGACGAATATGAAAAACAGACGAAAGAAAGGCTGAACAGTAAGGATATAGGCAAGGTGCCT
CCAAACCCGCCCGAGTCGGGAGCAGAAAACATCTTCGTCACGGTCTCTGGCCGAGTCCGGGCCCTGAACGACGAG
TTGGGGGTGCTTGAAAACGAATTGGCCATTCTGGATGGTGAAGACGGCGTGCTGAGGAAGTTGTGCAAGGGGCCC
AACTCTGGGTGCAAGGCGCAAAGTAACCCCGAGACTGACGAGGACGAGCCACCGCGTTTCTATGGGAACAAAAAG
AAGGGGACCTCGAGTATGGCCGACAAAGAGCAAGACGACGACGACGACGAACCACCGATATTCGACCCGAAGAAC
AAGAAAGCGGCGTCGAGTAGGGCCGATGAAGAGACCGGGAGGGACGGCGACGACGAGTCGGAGGCCGGCCGAAAG
AAAAAGAAAGCGAGCTCGAATGGGTCCGATGAGGAAGAAGACGAGGACGATCCACCCGACTTTGATGTTGGTAGC
GGGGGAGGCCAGCCGACTGCGGACAACCCAGACAACTCCGACGAAGACTCGGATGGTCGAAGGAAAGCAAAGAAG
AAGGGCTCCGGCAAGACACGGACGAGGGTGGATTCAGGAAACTAG
Gene >Hirsu2|1386
ATGGTTTGCAGGGTTCTTTCGTTGCTCTTTGCTCTTGCTACCATTGCAGGGGTAATCGGCGCCCCTGTCAAGGCC
GGACGTGCAGTCATCGGCTACAGACGCGTGAATCCGGTACGAAAACGGTGTCCTGGGGATGTTTGGCAAGAATGA
TGACTGAATTCGAGAAACTTTAGGAACAAGCCAAGAGATACAGCGATGCTGGCACCATCACTGATGATCCCACGG
GAAATGGCGGCGAGCAGATCGGCCATGGCGTTTACACCTCGGCCGTGCGAGGGGCGTGGAAAGGATCTCCTGGAG
ATGTGTTAGTATCTGCCCATGTACACTTGTACAGCCCTTTGTGATTTTGGGGACGACCTTTTGATTTAATTGCGC
GCGTTGCAGGGACTGTCAGATAACGGCCGAGAAGGACGTCTGGGACAAGCTGCCCAAAACGTGGATTCCCCGGAG
CGAGTGGTGGAAGAACGATGACGTTGACGCGTACATCAAAACGGTCGACAGCAGCTTGAAACCAGAAGATACTGT
GCGCTTGGCCTTGATTGACAAGATCCCAGAGGAACAGCTTCAGATGCTCCTCCCCAAGGCTTTACTCAAGAATCA
AGACCTACGGATAGAAACCAAGTGTGGAAACGACATTCAAGACTCGCCGCCCGTCGACTACGGCACCTGGGGCAA
CATCAAGGGCAACAGGTTCACCCGATCGGAGACAAAAGCAAGGGAGGTGATTCAAGAAATCCTGGACTCGGTGGT
GAAGATCAAGGCGGCCAACGAAAAGGTCAAGGACGCCAAAACACCGGAGGAGATCGAAACTCTAAGCAAAGAGGC
CAAGGAGAATCTCGACAAGGCCAAAGAATCGACAGAGAAGCTGGCCAAGGTCATAGAAGGCGCGAGGGGTGTGAA
AGAGCTCGCAGTCGCCGAGGGGGCAAAGCAGGCCTGCAAAGACTGCACCATGGACCACAAGACTTACCAGAACGG
TTTCAGCGCATATAGAGAGGCCAGAAGGGAGCACGCCTCATTCGTCGTGAAAAGCGCCGAGAGGGGTCTGAGCCT
GGTCGCGGGCCCAGGTTCGGGCGCCGAGAATACAGGCTCGGCCAAAGCTTTGAAGGATCTGGCTGCTAGAGTGGA
GAAGGAAGTCGAGTCGAAAAGGCGGAATAAGCAGCTCATCAAAGACGAACTCGACGAATATGAAAAACAGACGAA
AGAAAGGCTGAACAGTAAGGATATAGGCAAGGTGCCTCCAAACCCGCCCGAGTCGGGAGCAGAAAACATCTTCGT
CACGGTCTCTGGCCGAGTCCGGGCCCTGAACGACGAGTTGGGGGTGCTTGAAAACGAATTGGCCATTCTGGATGG
TGAAGACGGCGTGCTGAGGAAGTTGTGCAAGGGGCCCAACTCTGGGTGCAAGGCGCAAAGTAACCCCGAGACTGA
CGAGGACGAGCCACCGCGTTTCTATGGGAACAAAAAGAAGGGGACCTCGAGTATGGCCGACAAAGAGCAAGACGA
CGACGACGACGAACCACCGATATTCGACCCGAAGAACAAGAAAGCGGCGTCGAGTAGGGCCGATGAAGAGACCGG
GAGGGACGGCGACGACGAGTCGGAGGCCGGCCGAAAGAAAAAGAAAGCGAGCTCGAATGGGTCCGATGAGGAAGA
AGACGAGGACGATCCACCCGACTTTGATGTTGGTAGCGGGGGAGGCCAGCCGACTGCGGACAACCCAGACAACTC
CGACGAAGACTCGGATGGTCGAAGGAAAGCAAAGAAGAAGGGCTCCGGCAAGACACGGACGAGGGTGGATTCAGG
AAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail