Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1361
Gene name
LocationContig_13:20788..22850
Strand+
Gene length (bp)2062
Transcript length (bp)1974
Coding sequence length (bp)1974
Protein length (aa) 658

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.1E-37 164 565

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 160 651 7.0E-102
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 132 578 2.0E-57
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 155 643 8.0E-53
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 155 643 8.0E-53
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 139 613 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 160 651 7.0E-102
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 132 578 2.0E-57
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 155 643 8.0E-53
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 155 643 8.0E-53
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 139 613 2.0E-49
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 134 594 2.0E-49
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 156 619 1.0E-47
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 172 628 7.0E-47
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 139 613 7.0E-47
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 174 574 9.0E-36
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 248 594 4.0E-34
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 155 577 6.0E-34
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 174 538 1.0E-32
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 148 623 2.0E-27
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 160 569 3.0E-25
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 134 512 1.0E-23
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 160 500 6.0E-20
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 167 497 1.0E-18
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 196 643 4.0E-18
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 155 465 9.0E-18
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 163 338 2.0E-17
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 163 338 2.0E-17
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 156 581 6.0E-17
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 156 581 6.0E-17
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 146 483 1.0E-15
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 138 465 8.0E-15
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 144 468 1.0E-14
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 145 657 4.0E-14
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 169 621 4.0E-14
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 169 621 4.0E-14
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 145 471 6.0E-14
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 158 464 2.0E-13
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 164 467 2.0E-13
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 149 589 3.0E-13
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 149 589 3.0E-13
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 160 379 3.0E-13
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 157 490 1.0E-12
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 161 472 1.0E-12
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 161 472 1.0E-12
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 165 479 6.0E-12
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 157 490 7.0E-12
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 153 341 8.0E-12
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 169 478 2.0E-11
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 164 335 2.0E-11
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 140 476 2.0E-11
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 164 341 3.0E-11
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 164 343 4.0E-11
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 169 592 4.0E-11
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 164 343 6.0E-11
sp|P62967|TCR_STAES Tetracycline resistance protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tet PE=3 SV=1 164 419 7.0E-11
sp|P02983|TCR_STAAU Tetracycline resistance protein OS=Staphylococcus aureus GN=tet PE=3 SV=3 164 419 7.0E-11
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 152 341 8.0E-11
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 164 343 9.0E-11
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 164 343 9.0E-11
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 164 343 1.0E-10
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 164 343 1.0E-10
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 164 343 1.0E-10
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 164 343 1.0E-10
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 152 341 1.0E-10
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 152 341 1.0E-10
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 152 341 1.0E-10
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 152 341 1.0E-10
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 152 341 1.0E-10
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 152 341 1.0E-10
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 152 341 1.0E-10
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 152 341 1.0E-10
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 164 348 1.0E-10
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 164 335 1.0E-10
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 164 467 1.0E-10
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 161 327 1.0E-10
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 161 343 1.0E-10
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 164 467 1.0E-10
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 161 343 2.0E-10
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 164 467 2.0E-10
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 159 596 3.0E-10
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 149 534 5.0E-10
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 164 497 9.0E-10
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 161 510 2.0E-09
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 149 464 3.0E-09
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 149 464 3.0E-09
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 161 343 3.0E-09
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 161 343 3.0E-09
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 161 343 3.0E-09
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 161 343 3.0E-09
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 161 343 3.0E-09
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 161 343 3.0E-09
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 161 343 3.0E-09
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 161 343 3.0E-09
sp|P9WJX3|Y1634_MYCTU Probable multidrug-efflux transporter Rv1634 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1634 PE=1 SV=1 226 315 1.0E-08
sp|P9WJX2|Y1634_MYCTO Probable multidrug-efflux transporter MT1670 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1670 PE=3 SV=1 226 315 1.0E-08
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 76 589 4.0E-08
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 185 405 8.0E-08
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 153 465 2.0E-07
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 153 317 2.0E-07
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 153 317 2.0E-07
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 153 317 2.0E-07
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 153 317 3.0E-07
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 169 320 3.0E-07
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 153 313 3.0E-07
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 164 467 8.0E-07
sp|Q0T353|MDTD_SHIF8 Putative multidrug resistance protein MdtD OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtD PE=3 SV=2 164 335 2.0E-06
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 212 564 2.0E-06
sp|Q8FG02|MDTD_ECOL6 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtD PE=3 SV=1 164 335 2.0E-06
sp|Q323D8|MDTD_SHIBS Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtD PE=3 SV=1 164 346 2.0E-06
sp|B7MWZ0|MDTD_ECO81 Putative multidrug resistance protein MdtD OS=Escherichia coli O81 (strain ED1a) GN=mdtD PE=3 SV=1 164 335 2.0E-06
sp|Q0TG13|MDTD_ECOL5 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|B6HYS2|MDTD_ECOSE Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SE11) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|B2TYA6|MDTD_SHIB3 Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|P36554|MDTD_ECOLI Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12) GN=mdtD PE=1 SV=2 164 335 3.0E-06
sp|B1IYZ7|MDTD_ECOLC Putative multidrug resistance protein MdtD OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|A8A1U9|MDTD_ECOHS Putative multidrug resistance protein MdtD OS=Escherichia coli O9:H4 (strain HS) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|B1X7H3|MDTD_ECODH Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / DH10B) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|C4ZSG5|MDTD_ECOBW Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|B7L9V0|MDTD_ECO55 Putative multidrug resistance protein MdtD OS=Escherichia coli (strain 55989 / EAEC) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|Q3Z0C7|MDTD_SHISS Putative multidrug resistance protein MdtD OS=Shigella sonnei (strain Ss046) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|B5YUD5|MDTD_ECO5E Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|Q8X7I3|MDTD_ECO57 Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|B7NCB3|MDTD_ECOLU Putative multidrug resistance protein MdtD OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|B7M460|MDTD_ECO8A Putative multidrug resistance protein MdtD OS=Escherichia coli O8 (strain IAI1) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|A1ACT2|MDTD_ECOK1 Putative multidrug resistance protein MdtD OS=Escherichia coli O1:K1 / APEC GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|B7NQA9|MDTD_ECO7I Putative multidrug resistance protein MdtD OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|Q1R9Z4|MDTD_ECOUT Putative multidrug resistance protein MdtD OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|B7ME89|MDTD_ECO45 Putative multidrug resistance protein MdtD OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|B7UTB5|MDTD_ECO27 Putative multidrug resistance protein MdtD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtD PE=3 SV=1 164 335 3.0E-06
sp|A7ZNQ0|MDTD_ECO24 Putative multidrug resistance protein MdtD OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtD PE=3 SV=1 164 335 4.0E-06
sp|Q83QZ0|MDTD_SHIFL Putative multidrug resistance protein MdtD OS=Shigella flexneri GN=mdtD PE=3 SV=1 164 335 4.0E-06
sp|B1LNW4|MDTD_ECOSM Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtD PE=3 SV=1 164 335 4.0E-06
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 153 317 4.0E-06
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 146 359 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 160 182 22
2 197 219 22
3 226 248 22
4 253 275 22
5 282 304 22
6 309 331 22
7 352 374 22
8 384 401 17
9 421 443 22
10 453 475 22
11 482 504 22
12 514 531 17
13 552 574 22
14 620 642 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1361
MDPKRLQAEADLARLSVHLPKDTLSSSLATSSRYFLDDRETHYMARNISHWLSDDESQPATTAATPSTLPSLKFP
DRAAARNSHRHSKRNSQVRTSIILGTLPYDAVRPPGPNPATESKEKLQLLSGSGSGSDSGNIANQASGTREDGQE
YATGLKLTLIITALCFSVFLMALDNSIIATAIPRITDEFHSLNDVGWYGSAYMLTGSSFQLLFGKFYTFWSIKVV
FLSVIGLFEVGSLVCAIAPSSVVLIVGRAVAGIGSAGIFAGALTILAYTVPLEKRPLYSGLIGSMWGISSVAGPL
LGGVFTDRLTWRWCFYINLPIGFVSVIVIFFCFPDPQRTKEPRTWKDMFWQLDPLGTATFMPAIICLLLALHWGG
SQYAWDNARVTSLLMLSAFLVLIFLYVQYKMQDNATVPPRIMKKRTVWSSTIFEFFIGACFLLAMYFLPIWFQAI
KGASAVTSGTMNIPMLLSVVLFTVGSGIVVTSWGYYTPFIIAAAVLMPIGYGLMSTLNVDSGPAAWIGFQIIAGA
GVGIGMQQPLTAVQVVLDIADVPTGTAMIIFAQSLGGALFVTAGNTVFSNRLTAFLAEYAPKVDAQVVFAAGATG
IRSVIAPESLAGVVHAFNSALSNCFLVSTATASAAIVGAVMVEWKSVKGKNIEMAAA*
Coding >Hirsu2|1361
ATGGATCCGAAGCGGCTACAGGCCGAGGCCGACCTGGCCCGCCTCAGCGTCCACCTGCCCAAGGACACGCTCTCG
TCCTCCTTGGCCACCTCGTCGCGCTACTTCCTCGACGACCGCGAAACGCACTACATGGCCCGGAACATCTCCCAC
TGGCTGTCCGACGACGAGAGCCAGCCGGCGACGACGGCTGCGACGCCCAGCACCCTGCCCAGCCTCAAGTTCCCC
GACAGGGCCGCCGCCCGGAACAGCCACCGGCACAGCAAGCGGAACAGCCAGGTCCGGACGAGCATCATCCTCGGC
ACCCTCCCCTACGACGCCGTGCGCCCGCCCGGTCCGAACCCGGCCACCGAGAGCAAGGAGAAGCTGCAGCTGCTG
TCCGGGTCCGGGTCCGGGTCCGACTCCGGCAACATCGCCAACCAGGCCTCTGGCACCCGCGAGGACGGCCAGGAG
TACGCGACCGGGCTGAAGCTGACCCTCATCATCACCGCCCTGTGCTTCTCCGTCTTCCTCATGGCCCTGGATAAC
TCCATCATCGCGACGGCCATCCCCCGCATCACGGACGAGTTCCACAGCCTCAACGACGTCGGCTGGTACGGCTCC
GCCTACATGCTCACGGGCTCGTCCTTCCAGCTGCTCTTTGGCAAGTTCTACACCTTCTGGAGCATCAAGGTCGTC
TTCCTGTCCGTCATCGGCCTGTTCGAGGTCGGCAGCCTCGTCTGCGCCATCGCCCCCAGCAGCGTCGTGCTCATC
GTCGGCCGGGCCGTGGCCGGCATCGGGTCGGCCGGCATCTTCGCCGGCGCGCTGACCATCCTGGCCTACACGGTG
CCGCTGGAGAAGAGGCCGCTGTACAGCGGCCTGATCGGCAGCATGTGGGGCATCTCGTCGGTGGCCGGGCCGCTG
CTGGGCGGCGTCTTCACGGACCGGCTCACGTGGCGCTGGTGCTTCTACATCAACCTGCCCATCGGCTTCGTCTCC
GTCATCGTCATCTTCTTCTGCTTCCCGGATCCGCAGCGGACCAAGGAGCCGCGGACGTGGAAGGACATGTTCTGG
CAGCTCGACCCCCTCGGCACGGCCACCTTCATGCCGGCCATCATCTGCCTGCTGCTGGCGCTCCACTGGGGCGGC
TCGCAGTACGCGTGGGACAACGCGCGGGTGACGTCGCTGCTCATGCTCAGCGCCTTCCTCGTTCTCATCTTCCTC
TACGTGCAGTACAAGATGCAGGACAACGCGACGGTGCCGCCGCGGATCATGAAGAAGCGCACGGTGTGGTCGTCG
ACCATCTTCGAGTTCTTCATCGGCGCCTGCTTCCTGCTGGCCATGTACTTCTTGCCGATCTGGTTCCAGGCGATC
AAGGGCGCGTCGGCCGTGACGTCGGGCACCATGAACATCCCCATGCTCCTCAGCGTCGTTCTCTTCACCGTCGGC
TCCGGCATCGTCGTCACGTCGTGGGGCTACTACACGCCCTTCATCATCGCGGCGGCGGTGCTGATGCCCATCGGC
TACGGCCTCATGTCGACGCTCAACGTGGACTCGGGCCCGGCGGCCTGGATCGGCTTCCAGATCATCGCCGGGGCG
GGCGTGGGCATCGGCATGCAGCAGCCGCTGACGGCGGTGCAGGTGGTGCTGGACATCGCCGACGTGCCGACGGGG
ACGGCCATGATCATCTTCGCGCAGTCGCTGGGCGGAGCCCTGTTCGTGACGGCCGGCAACACCGTCTTCTCCAAC
CGGCTGACGGCCTTCCTGGCCGAGTACGCGCCCAAGGTGGACGCCCAGGTCGTCTTCGCGGCCGGCGCGACGGGC
ATCCGGAGCGTCATCGCGCCCGAGTCGCTGGCCGGCGTCGTGCACGCCTTCAACAGCGCGCTGTCCAACTGCTTC
CTCGTCTCGACGGCGACGGCGTCGGCGGCCATCGTCGGCGCCGTCATGGTGGAGTGGAAGAGCGTCAAGGGCAAG
AACATTGAGATGGCGGCAGCATGA
Transcript >Hirsu2|1361
ATGGATCCGAAGCGGCTACAGGCCGAGGCCGACCTGGCCCGCCTCAGCGTCCACCTGCCCAAGGACACGCTCTCG
TCCTCCTTGGCCACCTCGTCGCGCTACTTCCTCGACGACCGCGAAACGCACTACATGGCCCGGAACATCTCCCAC
TGGCTGTCCGACGACGAGAGCCAGCCGGCGACGACGGCTGCGACGCCCAGCACCCTGCCCAGCCTCAAGTTCCCC
GACAGGGCCGCCGCCCGGAACAGCCACCGGCACAGCAAGCGGAACAGCCAGGTCCGGACGAGCATCATCCTCGGC
ACCCTCCCCTACGACGCCGTGCGCCCGCCCGGTCCGAACCCGGCCACCGAGAGCAAGGAGAAGCTGCAGCTGCTG
TCCGGGTCCGGGTCCGGGTCCGACTCCGGCAACATCGCCAACCAGGCCTCTGGCACCCGCGAGGACGGCCAGGAG
TACGCGACCGGGCTGAAGCTGACCCTCATCATCACCGCCCTGTGCTTCTCCGTCTTCCTCATGGCCCTGGATAAC
TCCATCATCGCGACGGCCATCCCCCGCATCACGGACGAGTTCCACAGCCTCAACGACGTCGGCTGGTACGGCTCC
GCCTACATGCTCACGGGCTCGTCCTTCCAGCTGCTCTTTGGCAAGTTCTACACCTTCTGGAGCATCAAGGTCGTC
TTCCTGTCCGTCATCGGCCTGTTCGAGGTCGGCAGCCTCGTCTGCGCCATCGCCCCCAGCAGCGTCGTGCTCATC
GTCGGCCGGGCCGTGGCCGGCATCGGGTCGGCCGGCATCTTCGCCGGCGCGCTGACCATCCTGGCCTACACGGTG
CCGCTGGAGAAGAGGCCGCTGTACAGCGGCCTGATCGGCAGCATGTGGGGCATCTCGTCGGTGGCCGGGCCGCTG
CTGGGCGGCGTCTTCACGGACCGGCTCACGTGGCGCTGGTGCTTCTACATCAACCTGCCCATCGGCTTCGTCTCC
GTCATCGTCATCTTCTTCTGCTTCCCGGATCCGCAGCGGACCAAGGAGCCGCGGACGTGGAAGGACATGTTCTGG
CAGCTCGACCCCCTCGGCACGGCCACCTTCATGCCGGCCATCATCTGCCTGCTGCTGGCGCTCCACTGGGGCGGC
TCGCAGTACGCGTGGGACAACGCGCGGGTGACGTCGCTGCTCATGCTCAGCGCCTTCCTCGTTCTCATCTTCCTC
TACGTGCAGTACAAGATGCAGGACAACGCGACGGTGCCGCCGCGGATCATGAAGAAGCGCACGGTGTGGTCGTCG
ACCATCTTCGAGTTCTTCATCGGCGCCTGCTTCCTGCTGGCCATGTACTTCTTGCCGATCTGGTTCCAGGCGATC
AAGGGCGCGTCGGCCGTGACGTCGGGCACCATGAACATCCCCATGCTCCTCAGCGTCGTTCTCTTCACCGTCGGC
TCCGGCATCGTCGTCACGTCGTGGGGCTACTACACGCCCTTCATCATCGCGGCGGCGGTGCTGATGCCCATCGGC
TACGGCCTCATGTCGACGCTCAACGTGGACTCGGGCCCGGCGGCCTGGATCGGCTTCCAGATCATCGCCGGGGCG
GGCGTGGGCATCGGCATGCAGCAGCCGCTGACGGCGGTGCAGGTGGTGCTGGACATCGCCGACGTGCCGACGGGG
ACGGCCATGATCATCTTCGCGCAGTCGCTGGGCGGAGCCCTGTTCGTGACGGCCGGCAACACCGTCTTCTCCAAC
CGGCTGACGGCCTTCCTGGCCGAGTACGCGCCCAAGGTGGACGCCCAGGTCGTCTTCGCGGCCGGCGCGACGGGC
ATCCGGAGCGTCATCGCGCCCGAGTCGCTGGCCGGCGTCGTGCACGCCTTCAACAGCGCGCTGTCCAACTGCTTC
CTCGTCTCGACGGCGACGGCGTCGGCGGCCATCGTCGGCGCCGTCATGGTGGAGTGGAAGAGCGTCAAGGGCAAG
AACATTGAGATGGCGGCAGCATGA
Gene >Hirsu2|1361
ATGGATCCGAAGCGGCTACAGGCCGAGGCCGACCTGGCCCGCCTCAGCGTCCACCTGCCCAAGGACACGCTCTCG
TCCTCCTTGGCCACCTCGTCGCGCTACTTCCTCGACGACCGCGAAACGCACTACATGGCCCGGAACATCTCCCAC
TGGCTGTCCGACGACGAGAGCCAGCCGGCGACGACGGCTGCGACGCCCAGCACCCTGCCCAGCCTCAAGTTCCCC
GACAGGGCCGCCGCCCGGAACAGCCACCGGCACAGCAAGCGGAACAGCCAGGTCCGGACGAGCATCATCCTCGGC
ACCCTCCCCTACGACGCCGTGCGCCCGCCCGGTCCGAACCCGGCCACCGAGAGCAAGGAGAAGCTGCAGCTGCTG
TCCGGGTCCGGGTCCGGGTCCGACTCCGGCAACATCGCCAACCAGGCCTCTGGCACCCGCGAGGACGGCCAGGAG
TACGCGACCGGGCTGAAGCTGACCCTCATCATCACCGCCCTGTGCTTCTCCGTCTTCCTCATGGCCCTGGGTAAG
CCCGCTGTCCCCGACCCTCGGCCGCGCTCGAGGCGAGGCCGAGGGGCCCGCCGCCTGCAGCACGCACTCACACGC
GAGAGCAGATAACTCCATCATCGCGACGGCCATCCCCCGCATCACGGACGAGTTCCACAGCCTCAACGACGTCGG
CTGGTACGGCTCCGCCTACATGCTCACGGGCTCGTCCTTCCAGCTGCTCTTTGGCAAGTTCTACACCTTCTGGAG
CATCAAGGTCGTCTTCCTGTCCGTCATCGGCCTGTTCGAGGTCGGCAGCCTCGTCTGCGCCATCGCCCCCAGCAG
CGTCGTGCTCATCGTCGGCCGGGCCGTGGCCGGCATCGGGTCGGCCGGCATCTTCGCCGGCGCGCTGACCATCCT
GGCCTACACGGTGCCGCTGGAGAAGAGGCCGCTGTACAGCGGCCTGATCGGCAGCATGTGGGGCATCTCGTCGGT
GGCCGGGCCGCTGCTGGGCGGCGTCTTCACGGACCGGCTCACGTGGCGCTGGTGCTTCTACATCAACCTGCCCAT
CGGCTTCGTCTCCGTCATCGTCATCTTCTTCTGCTTCCCGGATCCGCAGCGGACCAAGGAGCCGCGGACGTGGAA
GGACATGTTCTGGCAGCTCGACCCCCTCGGCACGGCCACCTTCATGCCGGCCATCATCTGCCTGCTGCTGGCGCT
CCACTGGGGCGGCTCGCAGTACGCGTGGGACAACGCGCGGGTGACGTCGCTGCTCATGCTCAGCGCCTTCCTCGT
TCTCATCTTCCTCTACGTGCAGTACAAGATGCAGGACAACGCGACGGTGCCGCCGCGGATCATGAAGAAGCGCAC
GGTGTGGTCGTCGACCATCTTCGAGTTCTTCATCGGCGCCTGCTTCCTGCTGGCCATGTACTTCTTGCCGATCTG
GTTCCAGGCGATCAAGGGCGCGTCGGCCGTGACGTCGGGCACCATGAACATCCCCATGCTCCTCAGCGTCGTTCT
CTTCACCGTCGGCTCCGGCATCGTCGTCACGTCGTGGGGCTACTACACGCCCTTCATCATCGCGGCGGCGGTGCT
GATGCCCATCGGCTACGGCCTCATGTCGACGCTCAACGTGGACTCGGGCCCGGCGGCCTGGATCGGCTTCCAGAT
CATCGCCGGGGCGGGCGTGGGCATCGGCATGCAGCAGCCGCTGACGGCGGTGCAGGTGGTGCTGGACATCGCCGA
CGTGCCGACGGGGACGGCCATGATCATCTTCGCGCAGTCGCTGGGCGGAGCCCTGTTCGTGACGGCCGGCAACAC
CGTCTTCTCCAACCGGCTGACGGCCTTCCTGGCCGAGTACGCGCCCAAGGTGGACGCCCAGGTCGTCTTCGCGGC
CGGCGCGACGGGCATCCGGAGCGTCATCGCGCCCGAGTCGCTGGCCGGCGTCGTGCACGCCTTCAACAGCGCGCT
GTCCAACTGCTTCCTCGTCTCGACGGCGACGGCGTCGGCGGCCATCGTCGGCGCCGTCATGGTGGAGTGGAAGAG
CGTCAAGGGCAAGAACATTGAGATGGCGGCAGCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail