Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1358
Gene name
LocationContig_13:14329..15191
Strand+
Gene length (bp)862
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05821 NDUF_B8 NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI or NDUFB8) 1.4E-07 105 185

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0043227 membrane-bounded organelle No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 165 187 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1358
MLSRVRRIAAKQRPARLDLIPKLWTQLLANQAPASTSNWVPLSPRRLQGMLPQRIARAPALRSGLAATRRLPTTQ
RRGFLPPQYSDRKILDDKFPDRIQLSDAEDPEVNGGYINPPRIKRQFRDPYGDWWDKQERRNFGEPMHEDNDILG
MFSPHEYTWTTTGPALIMFGTFVATFLGVCGVVYLCYPDKPAYPREFEGGLERELGGPGARRARMPGDPDP*
Coding >Hirsu2|1358
ATGCTTAGCCGAGTACGACGAATAGCAGCTAAGCAACGCCCGGCTCGTCTCGACCTCATTCCCAAGCTCTGGACG
CAGCTGCTGGCCAACCAAGCGCCAGCTTCCACGAGCAATTGGGTGCCCCTGTCGCCTAGACGTCTGCAAGGAATG
CTCCCCCAGCGAATTGCGCGGGCCCCCGCCCTGCGCTCCGGCCTCGCGGCGACTCGACGATTGCCGACGACGCAG
CGACGAGGCTTCCTGCCACCGCAGTACTCAGACAGGAAAATTCTCGACGACAAGTTCCCGGACCGCATACAGCTG
AGCGATGCCGAGGACCCTGAAGTGAATGGCGGCTACATCAACCCGCCACGCATCAAGCGCCAGTTCCGCGACCCC
TACGGCGATTGGTGGGACAAACAGGAGCGGCGGAACTTTGGCGAGCCTATGCACGAGGATAATGACATACTCGGC
ATGTTCTCGCCCCACGAGTACACGTGGACGACGACCGGTCCGGCCCTGATCATGTTCGGCACCTTTGTCGCCACC
TTCCTGGGCGTGTGCGGAGTCGTCTACCTCTGCTACCCCGACAAGCCAGCGTATCCGAGAGAATTTGAAGGTGGA
TTGGAGAGGGAGCTCGGTGGCCCTGGCGCTAGGAGGGCGCGGATGCCCGGCGACCCGGACCCGTAA
Transcript >Hirsu2|1358
ATGCTTAGCCGAGTACGACGAATAGCAGCTAAGCAACGCCCGGCTCGTCTCGACCTCATTCCCAAGCTCTGGACG
CAGCTGCTGGCCAACCAAGCGCCAGCTTCCACGAGCAATTGGGTGCCCCTGTCGCCTAGACGTCTGCAAGGAATG
CTCCCCCAGCGAATTGCGCGGGCCCCCGCCCTGCGCTCCGGCCTCGCGGCGACTCGACGATTGCCGACGACGCAG
CGACGAGGCTTCCTGCCACCGCAGTACTCAGACAGGAAAATTCTCGACGACAAGTTCCCGGACCGCATACAGCTG
AGCGATGCCGAGGACCCTGAAGTGAATGGCGGCTACATCAACCCGCCACGCATCAAGCGCCAGTTCCGCGACCCC
TACGGCGATTGGTGGGACAAACAGGAGCGGCGGAACTTTGGCGAGCCTATGCACGAGGATAATGACATACTCGGC
ATGTTCTCGCCCCACGAGTACACGTGGACGACGACCGGTCCGGCCCTGATCATGTTCGGCACCTTTGTCGCCACC
TTCCTGGGCGTGTGCGGAGTCGTCTACCTCTGCTACCCCGACAAGCCAGCGTATCCGAGAGAATTTGAAGGTGGA
TTGGAGAGGGAGCTCGGTGGCCCTGGCGCTAGGAGGGCGCGGATGCCCGGCGACCCGGACCCGTAA
Gene >Hirsu2|1358
ATGCTTAGCCGAGTACGACGAATAGCAGCTAAGCAACGCCCGGCTCGTCTCGACCTCATTCCCAAGCTCTGGACG
CAGCTGCTGGCCAACCAAGCGCCAGCTTCCACGAGCAATTGGGTGCCCCTGTCGCCTAGACGTCTGCAAGGAGTA
ATGTCGCTCTTCTTTTCAAACCCTGAGGCCAGCTGCTAACCGCCGCGCTGCGCAGATGCTCCCCCAGCGAATTGC
GCGGGCCCCCGCCCTGCGCTCCGGCCTCGCGGCGACTCGACGATTGCCGACGACGCAGCGACGAGGCTTCCTGCC
ACCGCAGTACTCAGACAGGAAAATTCTCGACGACAAGTTCCCGGACCGCATACAGCTGAGCGATGCCGAGGACCC
TGAAGTGGTCAGTAACTTCCGGCGGCGGCGGCCGGAGACGGTCCAAGGTGCGGCACGCTGACAAGCCGTAAACGG
CAGAATGGCGGCTACATCAACCCGCCACGCATCAAGCGCCAGTTCCGCGACCCCTACGGCGATTGGTGGGACAAA
CAGGAGCGGCGGAACTTTGGCGAGCCTATGCACGAGGATAATGACATACTCGGCATGTTCTCGCCCCACGAGTAC
ACGTGGACGACGACCGGTCCGGCCCTGATCATGTTCGGCACCTTTGTCGCCACCTTCCTGGGCGTGTGCGGAGTC
GTCTACCTCTGCTACCCCGACAAGCCAGCGTATCCGAGAGAATTTGAAGGTGGATTGGAGAGGGAGCTCGGTGGC
CCTGGCGCTAGGAGGGTAGGTCGAGTCCATGTCCATCAGCTGGCTGCTGGAAGCATGGCATTAGCTTACGGTGAT
CTTGCAGGCGCGGATGCCCGGCGACCCGGACCCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail