Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1358
Gene name
LocationContig_13:14329..15191
Strand+
Gene length (bp)862
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05821 NDUF_B8 NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI or NDUFB8) 4.7E-08 106 161

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008137 NADH dehydrogenase (ubiquinone) activity Yes
GO:0003954 NADH dehydrogenase activity Yes
GO:0005739 mitochondrion Yes
GO:0005575 cellular_component No
GO:0016491 oxidoreductase activity No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0050136 NADH dehydrogenase (quinone) activity No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No
GO:0044424 intracellular part No
GO:0003674 molecular_function No
GO:0016651 oxidoreductase activity, acting on NAD(P)H No
GO:0003824 catalytic activity No
GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 165 187 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1358
MLSRVRRIAAKQRPARLDLIPKLWTQLLANQAPASTSNWVPLSPRRLQGMLPQRIARAPALRSGLAATRRLPTTQ
RRGFLPPQYSDRKILDDKFPDRIQLSDAEDPEVNGGYINPPRIKRQFRDPYGDWWDKQERRNFGEPMHEDNDILG
MFSPHEYTWTTTGPALIMFGTFVATFLGVCGVVYLCYPDKPAYPREFEGGLERELGGPGARRARMPGDPDP*
Coding >Hirsu2|1358
ATGCTTAGCCGAGTACGACGAATAGCAGCTAAGCAACGCCCGGCTCGTCTCGACCTCATTCCCAAGCTCTGGACG
CAGCTGCTGGCCAACCAAGCGCCAGCTTCCACGAGCAATTGGGTGCCCCTGTCGCCTAGACGTCTGCAAGGAATG
CTCCCCCAGCGAATTGCGCGGGCCCCCGCCCTGCGCTCCGGCCTCGCGGCGACTCGACGATTGCCGACGACGCAG
CGACGAGGCTTCCTGCCACCGCAGTACTCAGACAGGAAAATTCTCGACGACAAGTTCCCGGACCGCATACAGCTG
AGCGATGCCGAGGACCCTGAAGTGAATGGCGGCTACATCAACCCGCCACGCATCAAGCGCCAGTTCCGCGACCCC
TACGGCGATTGGTGGGACAAACAGGAGCGGCGGAACTTTGGCGAGCCTATGCACGAGGATAATGACATACTCGGC
ATGTTCTCGCCCCACGAGTACACGTGGACGACGACCGGTCCGGCCCTGATCATGTTCGGCACCTTTGTCGCCACC
TTCCTGGGCGTGTGCGGAGTCGTCTACCTCTGCTACCCCGACAAGCCAGCGTATCCGAGAGAATTTGAAGGTGGA
TTGGAGAGGGAGCTCGGTGGCCCTGGCGCTAGGAGGGCGCGGATGCCCGGCGACCCGGACCCGTAA
Transcript >Hirsu2|1358
ATGCTTAGCCGAGTACGACGAATAGCAGCTAAGCAACGCCCGGCTCGTCTCGACCTCATTCCCAAGCTCTGGACG
CAGCTGCTGGCCAACCAAGCGCCAGCTTCCACGAGCAATTGGGTGCCCCTGTCGCCTAGACGTCTGCAAGGAATG
CTCCCCCAGCGAATTGCGCGGGCCCCCGCCCTGCGCTCCGGCCTCGCGGCGACTCGACGATTGCCGACGACGCAG
CGACGAGGCTTCCTGCCACCGCAGTACTCAGACAGGAAAATTCTCGACGACAAGTTCCCGGACCGCATACAGCTG
AGCGATGCCGAGGACCCTGAAGTGAATGGCGGCTACATCAACCCGCCACGCATCAAGCGCCAGTTCCGCGACCCC
TACGGCGATTGGTGGGACAAACAGGAGCGGCGGAACTTTGGCGAGCCTATGCACGAGGATAATGACATACTCGGC
ATGTTCTCGCCCCACGAGTACACGTGGACGACGACCGGTCCGGCCCTGATCATGTTCGGCACCTTTGTCGCCACC
TTCCTGGGCGTGTGCGGAGTCGTCTACCTCTGCTACCCCGACAAGCCAGCGTATCCGAGAGAATTTGAAGGTGGA
TTGGAGAGGGAGCTCGGTGGCCCTGGCGCTAGGAGGGCGCGGATGCCCGGCGACCCGGACCCGTAA
Gene >Hirsu2|1358
ATGCTTAGCCGAGTACGACGAATAGCAGCTAAGCAACGCCCGGCTCGTCTCGACCTCATTCCCAAGCTCTGGACG
CAGCTGCTGGCCAACCAAGCGCCAGCTTCCACGAGCAATTGGGTGCCCCTGTCGCCTAGACGTCTGCAAGGAGTA
ATGTCGCTCTTCTTTTCAAACCCTGAGGCCAGCTGCTAACCGCCGCGCTGCGCAGATGCTCCCCCAGCGAATTGC
GCGGGCCCCCGCCCTGCGCTCCGGCCTCGCGGCGACTCGACGATTGCCGACGACGCAGCGACGAGGCTTCCTGCC
ACCGCAGTACTCAGACAGGAAAATTCTCGACGACAAGTTCCCGGACCGCATACAGCTGAGCGATGCCGAGGACCC
TGAAGTGGTCAGTAACTTCCGGCGGCGGCGGCCGGAGACGGTCCAAGGTGCGGCACGCTGACAAGCCGTAAACGG
CAGAATGGCGGCTACATCAACCCGCCACGCATCAAGCGCCAGTTCCGCGACCCCTACGGCGATTGGTGGGACAAA
CAGGAGCGGCGGAACTTTGGCGAGCCTATGCACGAGGATAATGACATACTCGGCATGTTCTCGCCCCACGAGTAC
ACGTGGACGACGACCGGTCCGGCCCTGATCATGTTCGGCACCTTTGTCGCCACCTTCCTGGGCGTGTGCGGAGTC
GTCTACCTCTGCTACCCCGACAAGCCAGCGTATCCGAGAGAATTTGAAGGTGGATTGGAGAGGGAGCTCGGTGGC
CCTGGCGCTAGGAGGGTAGGTCGAGTCCATGTCCATCAGCTGGCTGCTGGAAGCATGGCATTAGCTTACGGTGAT
CTTGCAGGCGCGGATGCCCGGCGACCCGGACCCGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail