Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1353
Gene name
LocationContig_1298:4861..6326
Strand+
Gene length (bp)1465
Transcript length (bp)1332
Coding sequence length (bp)1332
Protein length (aa) 444

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 2.5E-31 112 438

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 112 438 4.0E-53
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 101 436 1.0E-17
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 34 438 4.0E-14
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 15 432 4.0E-14
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 16 432 6.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 112 438 4.0E-53
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 101 436 1.0E-17
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 34 438 4.0E-14
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 15 432 4.0E-14
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 16 432 6.0E-14
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 164 438 4.0E-13
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 34 438 8.0E-13
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 161 438 4.0E-12
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 112 438 9.0E-12
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 163 436 3.0E-11
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 107 438 4.0E-11
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 163 436 2.0E-10
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 34 438 5.0E-10
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 107 430 5.0E-10
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 112 436 6.0E-10
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 101 438 6.0E-10
sp|O01530|ASP6_CAEEL Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 73 438 6.0E-09
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 163 430 9.0E-09
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 164 432 2.0E-08
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 107 430 2.0E-08
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 29 436 2.0E-08
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 95 441 3.0E-08
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 112 436 3.0E-08
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 166 432 7.0E-08
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 95 441 1.0E-07
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 29 436 2.0E-07
sp|P10602|CARP1_RHINI Rhizopuspepsin-1 OS=Rhizopus niveus GN=RNAP PE=1 SV=1 107 430 2.0E-07
sp|P03954|PEPA1_MACFU Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 29 436 2.0E-07
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 157 438 2.0E-07
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 164 438 3.0E-07
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 166 436 3.0E-07
sp|Q9HEZ3|PEPB_PENJA Aspartic protease pepB OS=Penicillium janthinellum GN=pepB PE=3 SV=1 32 438 3.0E-07
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 26 432 5.0E-07
sp|P00794|CHYM_BOVIN Chymosin OS=Bos taurus GN=CYM PE=1 SV=3 112 430 6.0E-07
sp|O93885|PEPA_EMENI Aspartic protease pep1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pep1 PE=3 SV=1 95 438 1.0E-06
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 166 436 2.0E-06
sp|Q4WNV0|CTSD_ASPFU Aspartic-type endopeptidase ctsD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ctsD PE=1 SV=1 101 442 2.0E-06
sp|C5FZ57|Y7979_ARTOC Putative aspergillopepsin A-like aspartic endopeptidase MCYG_07979 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07979 PE=3 SV=1 45 430 2.0E-06
sp|D4DE18|Y5382_TRIVH Probable aspartic-type endopeptidase TRV_05382 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05382 PE=3 SV=1 95 438 2.0E-06
sp|Q9N2D2|CHYM_CALJA Chymosin OS=Callithrix jacchus GN=CYM PE=1 SV=1 1 430 3.0E-06
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 166 436 4.0E-06
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 14 432 4.0E-06
sp|P18276|CHYM_SHEEP Chymosin OS=Ovis aries GN=CYM PE=2 SV=1 112 430 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1353
MRASCYLLGLLGGSFAVASLSGADLSKPLHGLRLKRIKTVRDPIPDRTARHLSRLHIIKGEPSAHSAASILGRVL
RTPPSRHEHTFQNISRAGAFSTQYAIQCAWDGLPVWLLLDTGSSDTWAVQTGFKCDNGGTPGTPGEAECSFGTPL
VDDFGGGAIQDLHFYLRYGSGEKITGPMGYSDLACGGVLVSDQQVGLANFTYWHGNNMTVGILGLAYPSITSAFY
GQIGNEAPWNAISYTPFLTNAIMQGVIDPVFSVALLKNSSGGILAWGGLPPQAWRRGRSAATDLIIANLNGQVET
SWRYSFYTIIPDGIRWGQTTDTTKFPYVIDTGTTTNYLPPPLAEAVAMAFQPRAVFLYQWGSYFAPCDAVPPRFA
VVISGVEFWINPADLIFHDLKDPLTGYCAVAIASGGSGPYILGDVFLQNVVAVFDVGAAQMRFYSRTS*
Coding >Hirsu2|1353
ATGAGAGCGTCTTGTTACTTGCTCGGCCTCTTGGGAGGCAGCTTCGCCGTGGCGTCGCTGTCCGGGGCGGACCTG
TCGAAGCCTCTCCACGGCCTTCGTCTGAAGCGCATCAAGACCGTGAGGGATCCGATCCCGGACCGGACGGCCCGG
CACTTGTCGCGCCTCCACATCATCAAGGGCGAGCCCAGCGCGCACAGCGCTGCCTCGATCCTCGGCCGGGTGCTG
CGCACGCCGCCCTCCCGCCACGAGCACACCTTTCAGAACATCAGCAGGGCCGGGGCCTTCTCGACCCAGTACGCC
ATTCAGTGCGCATGGGACGGCCTCCCCGTCTGGCTGCTCCTGGACACGGGCAGCTCCGACACCTGGGCCGTTCAG
ACGGGCTTCAAGTGCGATAACGGCGGCACGCCTGGCACGCCCGGCGAGGCGGAATGCAGCTTCGGGACGCCGCTC
GTCGACGATTTCGGCGGCGGCGCAATTCAAGACCTGCACTTTTACCTGAGGTACGGGTCCGGAGAGAAGATCACC
GGTCCGATGGGCTACAGCGACCTGGCCTGCGGTGGCGTCTTGGTCTCGGACCAGCAAGTCGGCCTGGCCAACTTT
ACCTACTGGCACGGGAACAACATGACGGTCGGCATTTTGGGTCTCGCCTATCCTTCCATCACCAGTGCCTTCTAT
GGCCAGATTGGCAACGAGGCGCCGTGGAACGCGATTTCGTACACGCCCTTCCTGACCAACGCCATCATGCAGGGG
GTCATTGACCCAGTCTTTAGCGTCGCTCTGCTCAAGAACTCGTCTGGAGGCATCCTCGCCTGGGGCGGGCTCCCG
CCCCAGGCCTGGCGGCGCGGCCGCTCTGCCGCGACCGACCTCATCATTGCCAATCTAAACGGCCAGGTCGAGACT
TCGTGGCGGTACTCGTTTTACACCATCATCCCGGATGGCATCAGATGGGGCCAGACGACGGACACGACCAAGTTC
CCGTACGTTATCGACACGGGAACGACAACGAATTACCTGCCGCCACCTTTGGCCGAGGCCGTGGCCATGGCGTTC
CAGCCGCGGGCAGTTTTCCTGTACCAGTGGGGATCGTATTTCGCGCCGTGCGATGCCGTGCCCCCGCGCTTCGCC
GTCGTCATTTCCGGCGTCGAGTTCTGGATTAACCCGGCAGACCTCATTTTCCACGACCTCAAGGACCCCTTGACG
GGGTACTGCGCCGTGGCCATAGCCAGTGGCGGATCCGGGCCCTACATCCTGGGGGACGTGTTCCTGCAGAACGTG
GTGGCCGTTTTTGACGTCGGCGCCGCCCAGATGCGCTTCTACTCGAGGACGTCCTAG
Transcript >Hirsu2|1353
ATGAGAGCGTCTTGTTACTTGCTCGGCCTCTTGGGAGGCAGCTTCGCCGTGGCGTCGCTGTCCGGGGCGGACCTG
TCGAAGCCTCTCCACGGCCTTCGTCTGAAGCGCATCAAGACCGTGAGGGATCCGATCCCGGACCGGACGGCCCGG
CACTTGTCGCGCCTCCACATCATCAAGGGCGAGCCCAGCGCGCACAGCGCTGCCTCGATCCTCGGCCGGGTGCTG
CGCACGCCGCCCTCCCGCCACGAGCACACCTTTCAGAACATCAGCAGGGCCGGGGCCTTCTCGACCCAGTACGCC
ATTCAGTGCGCATGGGACGGCCTCCCCGTCTGGCTGCTCCTGGACACGGGCAGCTCCGACACCTGGGCCGTTCAG
ACGGGCTTCAAGTGCGATAACGGCGGCACGCCTGGCACGCCCGGCGAGGCGGAATGCAGCTTCGGGACGCCGCTC
GTCGACGATTTCGGCGGCGGCGCAATTCAAGACCTGCACTTTTACCTGAGGTACGGGTCCGGAGAGAAGATCACC
GGTCCGATGGGCTACAGCGACCTGGCCTGCGGTGGCGTCTTGGTCTCGGACCAGCAAGTCGGCCTGGCCAACTTT
ACCTACTGGCACGGGAACAACATGACGGTCGGCATTTTGGGTCTCGCCTATCCTTCCATCACCAGTGCCTTCTAT
GGCCAGATTGGCAACGAGGCGCCGTGGAACGCGATTTCGTACACGCCCTTCCTGACCAACGCCATCATGCAGGGG
GTCATTGACCCAGTCTTTAGCGTCGCTCTGCTCAAGAACTCGTCTGGAGGCATCCTCGCCTGGGGCGGGCTCCCG
CCCCAGGCCTGGCGGCGCGGCCGCTCTGCCGCGACCGACCTCATCATTGCCAATCTAAACGGCCAGGTCGAGACT
TCGTGGCGGTACTCGTTTTACACCATCATCCCGGATGGCATCAGATGGGGCCAGACGACGGACACGACCAAGTTC
CCGTACGTTATCGACACGGGAACGACAACGAATTACCTGCCGCCACCTTTGGCCGAGGCCGTGGCCATGGCGTTC
CAGCCGCGGGCAGTTTTCCTGTACCAGTGGGGATCGTATTTCGCGCCGTGCGATGCCGTGCCCCCGCGCTTCGCC
GTCGTCATTTCCGGCGTCGAGTTCTGGATTAACCCGGCAGACCTCATTTTCCACGACCTCAAGGACCCCTTGACG
GGGTACTGCGCCGTGGCCATAGCCAGTGGCGGATCCGGGCCCTACATCCTGGGGGACGTGTTCCTGCAGAACGTG
GTGGCCGTTTTTGACGTCGGCGCCGCCCAGATGCGCTTCTACTCGAGGACGTCCTAG
Gene >Hirsu2|1353
ATGAGAGCGTCTTGTTACTTGCTCGGCCTCTTGGGAGGCAGCTTCGCCGTGGCGTCGCTGTCCGGGGCGGACCTG
TCGAAGCCTCTCCACGGCCTTCGTCTGAAGCGCATCAAGACCGTGAGGGATCCGATCCCGGACCGGACGGCCCGG
CACTTGTCGCGCCTCCACATCATCAAGGGCGAGCCCAGCGCGCACAGCGCTGCCTCGATCCTCGGCCGGGTGCTG
CGCACGCCGCCCTCCCGCCACGAGCACACCTTTCAGAACATCAGCAGGGCCGGGGCCTTCTCGACCCAGTACGCC
ATTCAGTGCGCATGGGACGGCCTCCCCGTCTGGCTGCTCCTGGACACGGGCAGCTCCGACACCTGGGCCGTTCAG
ACGGGCTTCAAGTGCGATAACGGCGGCACGCCTGGCACGCCCGGCGAGGCGGAATGCAGCTTCGGGACGCCGCTC
GTCGACGATTTCGGCGGCGGCGCAATTCAAGACCTGCACTTTTACCTGAGGTACGGGTCCGGAGAGAAGATCACC
GGTCCGATGGGCTACAGCGACCTGGCCTGCGGTGGCGTCTTGGTCTCGGACCAGCAAGTCGGCCTGGCCAACTTT
ACCTACTGGCACGGGAACAACATGACGGTCGGCATTTTGGGTCTCGCCTATCCTTCCATCACCAGTGCCTTCTAT
GGCCAGATTGGCAACGAGGCGCCGTGGAACGCGATTTCGTACACGCCCTTCCTGACCAACGCCATCATGCAGGGG
GTCATTGACCCAGTCTTTAGCGTCGCTCTGCTCAAGAACTCGTCTGGAGGCATCCTCGCCTGGGGCGGGCTCCCG
CCCCAGGCCTGGCGGCGCGGCCGCTCTGCCGCGACCGACCTCATCATTGTCAGTCGGGCCCCTTTTGGCTGACGT
GGTGACAGTCGTCGAGCTGACCGCAGGGGGAAAAAAAGGCCAATCTAAACGGCCAGGTCGAGACTTCGTGGCGGT
ACTCGTTTTACACCATCATCCCGGATGGCATCAGATGGGGCCAGACGACGGACACGACCAAGTTCCCGTACGTTA
TCGACACGGGAACGACAACGAATTACCTGCCGCCACGTGAGCCATCATGACCCCCCTTTCCTTTGCTGGTCCCGT
GAATGGGAGGCTGACGTCTCTTACAACAGCTTTGGCCGAGGCCGTGGCCATGGCGTTCCAGCCGCGGGCAGTTTT
CCTGTACCAGTGGGGATCGTATTTCGCGCCGTGCGATGCCGTGCCCCCGCGCTTCGCCGTCGTCATTTCCGGCGT
CGAGTTCTGGATTAACCCGGCAGACCTCATTTTCCACGACCTCAAGGACCCCTTGACGGGGTACTGCGCCGTGGC
CATAGCCAGTGGCGGATCCGGGCCCTACATCCTGGGGGACGTGTTCCTGCAGAACGTGGTGGCCGTTTTTGACGT
CGGCGCCGCCCAGATGCGCTTCTACTCGAGGACGTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail