Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1350
Gene name
LocationContig_1296:6440..7064
Strand-
Gene length (bp)624
Transcript length (bp)624
Coding sequence length (bp)624
Protein length (aa) 208

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05875 Ceramidase Ceramidase 6.4E-39 12 204

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9D099|ACER3_MOUSE Alkaline ceramidase 3 OS=Mus musculus GN=Acer3 PE=2 SV=1 7 186 1.0E-13
sp|Q9NUN7|ACER3_HUMAN Alkaline ceramidase 3 OS=Homo sapiens GN=ACER3 PE=1 SV=3 1 186 6.0E-13
sp|P38298|YPC1_YEAST Alkaline ceramidase YPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPC1 PE=1 SV=1 7 185 3.0E-12
sp|Q02896|YDC1_YEAST Alkaline ceramidase YDC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDC1 PE=1 SV=1 7 197 1.0E-11

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006672 ceramide metabolic process Yes
GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Yes
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0044425 membrane part No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0044237 cellular metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006665 sphingolipid metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044255 cellular lipid metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 68 87 19
3 92 114 22
4 129 151 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1350
MYGRDSRGLLAPRLDFMSISLLCLGIGSFLFHASLRATFEFADEFSMLGLTWSMLQSTLTVRQPHWKAHSISVCL
AICFTSFSALYLQSPDIIYQVIAFATGLFVVILRSQYLFHWLQPAYPKAKSRDWNVRTWKAIALCLVGYALWNID
LQYCAELRQIRHRVGLPCAWLFELHGWWHVLTAIGASQFMDVAREVRQHSKQEQMNE*
Coding >Hirsu2|1350
ATGTACGGCCGTGATAGCCGCGGGCTGCTTGCGCCAAGGTTGGACTTTATGTCTATCTCGCTTCTCTGCCTCGGC
ATCGGCTCCTTCCTCTTCCACGCCAGTCTCCGCGCGACATTCGAATTCGCCGACGAGTTCTCCATGCTCGGCCTG
ACGTGGTCGATGCTCCAGTCTACCCTCACAGTACGACAACCACATTGGAAGGCTCACTCGATCTCGGTCTGCTTG
GCTATTTGCTTCACCTCATTTTCTGCGCTGTATCTGCAGTCGCCAGACATCATTTACCAAGTCATTGCCTTCGCA
ACAGGCCTATTTGTGGTAATTCTACGCAGCCAGTACCTATTCCACTGGCTTCAGCCAGCATATCCAAAAGCCAAG
AGCCGGGACTGGAACGTGCGGACGTGGAAAGCAATTGCCCTATGTCTCGTTGGGTACGCGCTCTGGAACATTGAT
CTCCAGTACTGCGCGGAGCTCAGGCAGATCAGACACCGCGTCGGGCTCCCCTGTGCTTGGCTGTTTGAGTTACAT
GGATGGTGGCATGTCTTGACGGCCATTGGCGCCAGCCAGTTCATGGACGTGGCCCGAGAAGTGCGCCAACACTCG
AAGCAAGAGCAGATGAACGAATAA
Transcript >Hirsu2|1350
ATGTACGGCCGTGATAGCCGCGGGCTGCTTGCGCCAAGGTTGGACTTTATGTCTATCTCGCTTCTCTGCCTCGGC
ATCGGCTCCTTCCTCTTCCACGCCAGTCTCCGCGCGACATTCGAATTCGCCGACGAGTTCTCCATGCTCGGCCTG
ACGTGGTCGATGCTCCAGTCTACCCTCACAGTACGACAACCACATTGGAAGGCTCACTCGATCTCGGTCTGCTTG
GCTATTTGCTTCACCTCATTTTCTGCGCTGTATCTGCAGTCGCCAGACATCATTTACCAAGTCATTGCCTTCGCA
ACAGGCCTATTTGTGGTAATTCTACGCAGCCAGTACCTATTCCACTGGCTTCAGCCAGCATATCCAAAAGCCAAG
AGCCGGGACTGGAACGTGCGGACGTGGAAAGCAATTGCCCTATGTCTCGTTGGGTACGCGCTCTGGAACATTGAT
CTCCAGTACTGCGCGGAGCTCAGGCAGATCAGACACCGCGTCGGGCTCCCCTGTGCTTGGCTGTTTGAGTTACAT
GGATGGTGGCATGTCTTGACGGCCATTGGCGCCAGCCAGTTCATGGACGTGGCCCGAGAAGTGCGCCAACACTCG
AAGCAAGAGCAGATGAACGAATAA
Gene >Hirsu2|1350
ATGTACGGCCGTGATAGCCGCGGGCTGCTTGCGCCAAGGTTGGACTTTATGTCTATCTCGCTTCTCTGCCTCGGC
ATCGGCTCCTTCCTCTTCCACGCCAGTCTCCGCGCGACATTCGAATTCGCCGACGAGTTCTCCATGCTCGGCCTG
ACGTGGTCGATGCTCCAGTCTACCCTCACAGTACGACAACCACATTGGAAGGCTCACTCGATCTCGGTCTGCTTG
GCTATTTGCTTCACCTCATTTTCTGCGCTGTATCTGCAGTCGCCAGACATCATTTACCAAGTCATTGCCTTCGCA
ACAGGCCTATTTGTGGTAATTCTACGCAGCCAGTACCTATTCCACTGGCTTCAGCCAGCATATCCAAAAGCCAAG
AGCCGGGACTGGAACGTGCGGACGTGGAAAGCAATTGCCCTATGTCTCGTTGGGTACGCGCTCTGGAACATTGAT
CTCCAGTACTGCGCGGAGCTCAGGCAGATCAGACACCGCGTCGGGCTCCCCTGTGCTTGGCTGTTTGAGTTACAT
GGATGGTGGCATGTCTTGACGGCCATTGGCGCCAGCCAGTTCATGGACGTGGCCCGAGAAGTGCGCCAACACTCG
AAGCAAGAGCAGATGAACGAATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail