Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1343
Gene name
LocationContig_1295:663..2259
Strand-
Gene length (bp)1596
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09692 Arb1 Argonaute siRNA chaperone (ARC) complex subunit Arb1 6.4E-120 54 440

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7B8|ARB1_SCHPO Argonaute-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arb1 PE=1 SV=1 40 274 2.0E-22

GO

GO Term Description Terminal node
GO:0031047 gene silencing by RNA Yes
GO:0033167 ARC complex Yes
GO:0048519 negative regulation of biological process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0044422 organelle part No
GO:0008150 biological_process No
GO:0019222 regulation of metabolic process No
GO:0044428 nuclear part No
GO:0010468 regulation of gene expression No
GO:0009892 negative regulation of metabolic process No
GO:0065007 biological regulation No
GO:1990904 ribonucleoprotein complex No
GO:0044446 intracellular organelle part No
GO:0010629 negative regulation of gene expression No
GO:0044464 cell part No
GO:0050789 regulation of biological process No
GO:0044424 intracellular part No
GO:0016458 gene silencing No
GO:0031332 RNAi effector complex No
GO:0032991 protein-containing complex No
GO:0010605 negative regulation of macromolecule metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1343
MSSPEPVQDPAAPEAASPHPPADAEGHDAQPGTGIEAQPKKKKAKPAARRGPTALPKNRGTGFEEYFADPPMTPE
EAAEEKTQIYARDLPFEERIQACIQRFRSRRRLRERQALFFNEYLFLGGVDTSPNAFVGLDPKDLQGLTPAQRRD
ATAADAVHSGSAADDRFYHGDDEHWTVDFAGVVAGFLSTSLVTMTNSCRSEMESGTAVVENFLRYILHHEVCPEY
EDDVGGALRLCADARNEWPLLDRLRASLPGPFHTAAAELFSTSNSRDWDCRSYQQPGDFDARAKFYSACALLGET
STLRLAARGADVGVVREDDCAIEVVEIEQPSQVVAQQFRRLHLGGKPLGMAPMGRVLFKQATIEDGWETPVVPMP
VPDGAPGIWLYFDVTALADLRPGMKMALRLVELETGVTFVKSLLRIVPTYHSFLPQLLMKHYKRPRDDERPAASV
HDPHAEDKQHDGETEA*
Coding >Hirsu2|1343
ATGTCATCCCCTGAGCCTGTCCAGGATCCTGCGGCCCCCGAGGCTGCCTCGCCCCATCCTCCAGCCGATGCAGAG
GGCCATGACGCTCAGCCCGGCACCGGCATCGAGGCGCAGCCCAAGAAGAAGAAGGCCAAGCCGGCCGCAAGGCGT
GGCCCGACCGCCCTGCCCAAGAACCGCGGCACGGGATTCGAAGAATACTTCGCCGATCCGCCCATGACCCCGGAG
GAAGCTGCCGAGGAGAAGACTCAGATCTATGCCAGGGATCTTCCATTCGAGGAGCGCATCCAGGCCTGCATCCAA
CGCTTTCGATCCCGCCGGCGTCTGCGGGAGAGACAGGCCCTCTTCTTCAACGAGTACCTGTTTCTCGGTGGCGTC
GACACGTCCCCCAATGCCTTCGTGGGGCTCGACCCCAAGGACCTGCAGGGCCTGACGCCTGCCCAACGACGCGAT
GCCACGGCCGCAGACGCGGTCCACAGCGGCTCCGCCGCCGACGACCGCTTCTACCACGGCGACGACGAGCACTGG
ACCGTCGACTTTGCCGGCGTCGTAGCCGGCTTCCTGTCGACCTCGCTGGTCACCATGACGAACAGCTGCCGGAGC
GAGATGGAATCCGGCACGGCCGTCGTGGAGAACTTCCTCAGATACATCCTGCACCATGAAGTGTGCCCCGAGTAC
GAGGATGACGTCGGCGGCGCGCTTCGGCTCTGCGCAGACGCGAGGAACGAGTGGCCGCTCCTGGACAGGCTGCGT
GCCTCGCTGCCAGGGCCCTTTCACACGGCTGCGGCGGAACTCTTTTCCACCTCGAACTCCCGCGACTGGGACTGC
CGAAGCTACCAGCAGCCTGGCGATTTCGACGCCAGGGCAAAGTTTTACTCGGCATGTGCCCTTCTGGGCGAGACG
TCGACCCTGAGACTCGCCGCTCGTGGGGCTGATGTCGGAGTGGTCAGAGAGGACGACTGCGCCATCGAGGTGGTC
GAGATCGAGCAGCCCAGCCAGGTTGTGGCCCAGCAGTTCAGACGCCTCCACTTGGGGGGCAAACCGCTTGGAATG
GCGCCGATGGGCAGGGTGCTGTTCAAGCAAGCCACGATCGAGGACGGGTGGGAGACGCCGGTGGTGCCCATGCCC
GTTCCCGATGGCGCGCCCGGCATATGGCTGTATTTCGACGTGACGGCCCTGGCCGACCTGAGACCGGGCATGAAG
ATGGCGCTCCGCCTCGTCGAGCTCGAGACGGGCGTCACGTTCGTCAAGTCGCTGCTGCGGATCGTGCCGACCTAC
CACAGCTTCCTGCCGCAGCTGCTCATGAAGCACTACAAGCGGCCGAGGGACGACGAGCGGCCCGCGGCATCGGTG
CACGACCCGCACGCGGAGGACAAGCAGCACGACGGGGAGACGGAGGCATAG
Transcript >Hirsu2|1343
ATGTCATCCCCTGAGCCTGTCCAGGATCCTGCGGCCCCCGAGGCTGCCTCGCCCCATCCTCCAGCCGATGCAGAG
GGCCATGACGCTCAGCCCGGCACCGGCATCGAGGCGCAGCCCAAGAAGAAGAAGGCCAAGCCGGCCGCAAGGCGT
GGCCCGACCGCCCTGCCCAAGAACCGCGGCACGGGATTCGAAGAATACTTCGCCGATCCGCCCATGACCCCGGAG
GAAGCTGCCGAGGAGAAGACTCAGATCTATGCCAGGGATCTTCCATTCGAGGAGCGCATCCAGGCCTGCATCCAA
CGCTTTCGATCCCGCCGGCGTCTGCGGGAGAGACAGGCCCTCTTCTTCAACGAGTACCTGTTTCTCGGTGGCGTC
GACACGTCCCCCAATGCCTTCGTGGGGCTCGACCCCAAGGACCTGCAGGGCCTGACGCCTGCCCAACGACGCGAT
GCCACGGCCGCAGACGCGGTCCACAGCGGCTCCGCCGCCGACGACCGCTTCTACCACGGCGACGACGAGCACTGG
ACCGTCGACTTTGCCGGCGTCGTAGCCGGCTTCCTGTCGACCTCGCTGGTCACCATGACGAACAGCTGCCGGAGC
GAGATGGAATCCGGCACGGCCGTCGTGGAGAACTTCCTCAGATACATCCTGCACCATGAAGTGTGCCCCGAGTAC
GAGGATGACGTCGGCGGCGCGCTTCGGCTCTGCGCAGACGCGAGGAACGAGTGGCCGCTCCTGGACAGGCTGCGT
GCCTCGCTGCCAGGGCCCTTTCACACGGCTGCGGCGGAACTCTTTTCCACCTCGAACTCCCGCGACTGGGACTGC
CGAAGCTACCAGCAGCCTGGCGATTTCGACGCCAGGGCAAAGTTTTACTCGGCATGTGCCCTTCTGGGCGAGACG
TCGACCCTGAGACTCGCCGCTCGTGGGGCTGATGTCGGAGTGGTCAGAGAGGACGACTGCGCCATCGAGGTGGTC
GAGATCGAGCAGCCCAGCCAGGTTGTGGCCCAGCAGTTCAGACGCCTCCACTTGGGGGGCAAACCGCTTGGAATG
GCGCCGATGGGCAGGGTGCTGTTCAAGCAAGCCACGATCGAGGACGGGTGGGAGACGCCGGTGGTGCCCATGCCC
GTTCCCGATGGCGCGCCCGGCATATGGCTGTATTTCGACGTGACGGCCCTGGCCGACCTGAGACCGGGCATGAAG
ATGGCGCTCCGCCTCGTCGAGCTCGAGACGGGCGTCACGTTCGTCAAGTCGCTGCTGCGGATCGTGCCGACCTAC
CACAGCTTCCTGCCGCAGCTGCTCATGAAGCACTACAAGCGGCCGAGGGACGACGAGCGGCCCGCGGCATCGGTG
CACGACCCGCACGCGGAGGACAAGCAGCACGACGGGGAGACGGAGGCATAG
Gene >Hirsu2|1343
ATGTCATCCCCTGAGCCTGTCCAGGATCCTGCGGCCCCCGAGGCTGCCTCGCCCCATCCTCCAGCCGATGCAGAG
GGCCATGACGCTCAGCCCGGCACCGGCATCGAGGCGCAGCCCAAGAAGAAGAAGGCCAAGCCGGCCGCAAGGCGT
GGCCCGACCGCCCTGCCCAAGAACCGCGGCACGGGATTCGAAGGTACGTCGACCCTGAATCCATGCGGTTGTCCC
TCGTGCCGGGACTGAGCCTCCATCAGAATACTTCGCCGATCCGCCCATGACCCCGGAGGAAGCTGCCGAGGAGAA
GACTCAGATCTATGCCAGGTGTGTGAGGGCGTGCTGCGCCACCTTGATGCAGGAGACACGAGTGCAGGACTTTGA
CTGACATGGAGCTCAGGGATCTTCCATTCGAGGAGTGAGCCATCACCACCCTCTTTCCAGTCGGTCTTTGTGGCG
AGTGGCTGACGTGGACTACTCAGGCGCATCCAGGCCTGCATCCAACGCTTTCGATCCCGCCGGCGTCTGCGGGAG
AGACAGGCCCTCTTCTTCAACGAGTACCTGTTTCTCGGTGGCGTCGACACGTCCCCCAATGCCTTCGTGGGGCTC
GACCCCAAGGACCTGCAGGGCCTGACGCCTGCCCAACGACGCGATGCCACGGCCGCAGACGCGGTCCACAGCGGC
TCCGCCGCCGACGACCGCTTCTACCACGGCGACGACGAGCACTGGACCGTCGACTTTGCCGGCGTCGTAGCCGGC
TTCCTGTCGACCTCGCTGGTCACCATGACGAACAGCTGCCGGAGCGAGATGGAATCCGGCACGGCCGTCGTGGAG
AACTTCCTCAGATACATCCTGCACCATGAAGTGTGCCCCGAGTACGAGGATGACGTCGGCGGCGCGCTTCGGCTC
TGCGCAGACGCGAGGAACGAGTGGCCGCTCCTGGACAGGCTGCGTGCCTCGCTGCCAGGGCCCTTTCACACGGCT
GCGGCGGAACTCTTTTCCACCTCGAACTCCCGCGACTGGGACTGCCGAAGCTACCAGCAGCCTGGCGATTTCGAC
GCCAGGGCAAAGTTTTACTCGGCATGTGCCCTTCTGGGCGAGACGTCGACCCTGAGACTCGCCGCTCGTGGGGCT
GATGTCGGAGTGGTCAGAGAGGACGACTGCGCCATCGAGGTGGTCGAGATCGAGCAGCCCAGCCAGGTTGTGGCC
CAGCAGTTCAGACGCCTCCACTTGGGGGGCAAACCGCTTGGAATGGCGCCGATGGGCAGGGTGCTGTTCAAGCAA
GCCACGATCGAGGACGGGTGGGAGACGCCGGTGGTGCCCATGCCCGTTCCCGATGGCGCGCCCGGCATATGGCTG
TATTTCGACGTGACGGCCCTGGCCGACCTGAGACCGGGCATGAAGATGGCGCTCCGCCTCGTCGAGCTCGAGACG
GGCGTCACGTTCGTCAAGTCGCTGCTGCGGATCGTGCCGACCTACCACAGCTTCCTGCCGCAGCTGCTCATGAAG
CACTACAAGCGGCCGAGGGACGACGAGCGGCCCGCGGCATCGGTGCACGACCCGCACGCGGAGGACAAGCAGCAC
GACGGGGAGACGGAGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail