Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1338
Gene name
LocationContig_1293:3586..4287
Strand-
Gene length (bp)701
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00179 UQ_con Ubiquitin-conjugating enzyme 1.4E-49 36 171
PF14461 Prok-E2_B Prokaryotic E2 family B 1.7E-07 71 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O00103|UBC11_SCHPO Ubiquitin-conjugating enzyme E2-20 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc11 PE=3 SV=1 1 179 7.0E-74
sp|P52492|UBC11_YEAST Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC11 PE=1 SV=1 32 179 2.0E-61
sp|Q54XS6|UBE2C_DICDI Probable ubiquitin-conjugating enzyme E2 C OS=Dictyostelium discoideum GN=ube2c PE=3 SV=1 31 176 6.0E-56
sp|Q95044|UBE2C_SPISO Ubiquitin-conjugating enzyme E2 C OS=Spisula solidissima GN=UBE2C PE=1 SV=1 9 175 7.0E-55
sp|Q9VTY6|UBE2C_DROME Ubiquitin-conjugating enzyme E2 C OS=Drosophila melanogaster GN=vih PE=1 SV=1 29 176 2.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O00103|UBC11_SCHPO Ubiquitin-conjugating enzyme E2-20 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc11 PE=3 SV=1 1 179 7.0E-74
sp|P52492|UBC11_YEAST Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC11 PE=1 SV=1 32 179 2.0E-61
sp|Q54XS6|UBE2C_DICDI Probable ubiquitin-conjugating enzyme E2 C OS=Dictyostelium discoideum GN=ube2c PE=3 SV=1 31 176 6.0E-56
sp|Q95044|UBE2C_SPISO Ubiquitin-conjugating enzyme E2 C OS=Spisula solidissima GN=UBE2C PE=1 SV=1 9 175 7.0E-55
sp|Q9VTY6|UBE2C_DROME Ubiquitin-conjugating enzyme E2 C OS=Drosophila melanogaster GN=vih PE=1 SV=1 29 176 2.0E-52
sp|Q9D1C1|UBE2C_MOUSE Ubiquitin-conjugating enzyme E2 C OS=Mus musculus GN=Ube2c PE=1 SV=1 8 167 2.0E-51
sp|Q4R9D1|UBE2C_MACFA Ubiquitin-conjugating enzyme E2 C OS=Macaca fascicularis GN=UBE2C PE=2 SV=1 8 167 7.0E-51
sp|Q32PA5|UBE2C_BOVIN Ubiquitin-conjugating enzyme E2 C OS=Bos taurus GN=UBE2C PE=2 SV=1 8 167 1.0E-50
sp|O00762|UBE2C_HUMAN Ubiquitin-conjugating enzyme E2 C OS=Homo sapiens GN=UBE2C PE=1 SV=1 8 167 2.0E-50
sp|Q9LJZ5|UBC19_ARATH Ubiquitin-conjugating enzyme E2 19 OS=Arabidopsis thaliana GN=UBC19 PE=1 SV=1 26 175 2.0E-50
sp|P56616|UBE2C_XENLA Ubiquitin-conjugating enzyme E2 C OS=Xenopus laevis GN=ube2c PE=1 SV=1 8 159 2.0E-49
sp|Q8L7T3|UBC20_ARATH Ubiquitin-conjugating enzyme E2 20 OS=Arabidopsis thaliana GN=UBC20 PE=2 SV=1 26 173 2.0E-43
sp|Q95XX0|UBC13_CAEEL Ubiquitin-conjugating enzyme E2 13 OS=Caenorhabditis elegans GN=ubc-13 PE=1 SV=2 35 165 2.0E-38
sp|P35128|UBE2N_DROME Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster GN=ben PE=2 SV=1 32 165 4.0E-38
sp|Q4R4I1|UBE2N_MACFA Ubiquitin-conjugating enzyme E2 N OS=Macaca fascicularis GN=UBE2N PE=2 SV=1 35 159 5.0E-38
sp|Q94A97|UBC35_ARATH Ubiquitin-conjugating enzyme E2 35 OS=Arabidopsis thaliana GN=UBC35 PE=1 SV=1 35 165 1.0E-37
sp|Q86K32|UBE2N_DICDI Probable ubiquitin-conjugating enzyme E2 N OS=Dictyostelium discoideum GN=ube2n PE=3 SV=2 32 176 2.0E-37
sp|Q9FZ48|UBC36_ARATH Ubiquitin-conjugating enzyme E2 36 OS=Arabidopsis thaliana GN=UBC36 PE=1 SV=1 35 165 4.0E-37
sp|Q9EQX9|UBE2N_RAT Ubiquitin-conjugating enzyme E2 N OS=Rattus norvegicus GN=Ube2n PE=1 SV=1 35 159 4.0E-37
sp|P25865|UBC1_ARATH Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana GN=UBC1 PE=1 SV=1 35 180 4.0E-37
sp|Q5R7J6|UBE2N_PONAB Ubiquitin-conjugating enzyme E2 N OS=Pongo abelii GN=UBE2N PE=2 SV=1 35 159 4.0E-37
sp|P61089|UBE2N_MOUSE Ubiquitin-conjugating enzyme E2 N OS=Mus musculus GN=Ube2n PE=1 SV=1 35 159 4.0E-37
sp|P61088|UBE2N_HUMAN Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens GN=UBE2N PE=1 SV=1 35 159 4.0E-37
sp|Q0P5K3|UBE2N_BOVIN Ubiquitin-conjugating enzyme E2 N OS=Bos taurus GN=UBE2N PE=2 SV=1 35 159 4.0E-37
sp|P23566|UBC2_SCHPO Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp6 PE=1 SV=3 30 170 6.0E-37
sp|Q8S920|UBC5A_ORYSJ Ubiquitin-conjugating enzyme E2 5A OS=Oryza sativa subsp. japonica GN=UBC5A PE=2 SV=1 34 168 1.0E-36
sp|P35130|UBC2_MEDSA Ubiquitin-conjugating enzyme E2 2 OS=Medicago sativa GN=UBC2 PE=2 SV=1 35 180 2.0E-36
sp|Q4WLA7|UBC2_ASPFU Ubiquitin-conjugating enzyme E2 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ubc2 PE=3 SV=1 30 170 3.0E-36
sp|Q96UP5|UBC2_EMENI Ubiquitin-conjugating enzyme E2 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uvsJ PE=3 SV=1 30 170 3.0E-36
sp|P42745|UBC2_ARATH Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana GN=UBC2 PE=2 SV=1 35 180 3.0E-36
sp|P25866|UBC2_WHEAT Ubiquitin-conjugating enzyme E2 2 OS=Triticum aestivum GN=UBC2 PE=1 SV=1 35 180 4.0E-36
sp|P42746|UBC3_ARATH Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana GN=UBC3 PE=2 SV=1 35 171 4.0E-36
sp|P52490|UBC13_YEAST Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC13 PE=1 SV=1 32 169 7.0E-36
sp|Q9C9Y7|UBC12_ARATH Probable ubiquitin-conjugating enzyme E2 12 OS=Arabidopsis thaliana GN=UBC12 PE=2 SV=1 34 168 1.0E-35
sp|Q6C093|UBC2_YARLI Ubiquitin-conjugating enzyme E2 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBC2 PE=3 SV=1 30 170 1.0E-35
sp|P52493|UBC2_NEUCR Ubiquitin-conjugating enzyme E2 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-8 PE=3 SV=4 30 170 1.0E-35
sp|Q9Z255|UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A OS=Mus musculus GN=Ube2a PE=1 SV=1 35 172 1.0E-35
sp|P49459|UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens GN=UBE2A PE=1 SV=2 35 172 1.0E-35
sp|P63149|UBE2B_RAT Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus GN=Ube2b PE=2 SV=1 35 172 2.0E-35
sp|P63148|UBE2B_RABIT Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus cuniculus GN=UBE2B PE=2 SV=1 35 172 2.0E-35
sp|P63147|UBE2B_MOUSE Ubiquitin-conjugating enzyme E2 B OS=Mus musculus GN=Ube2b PE=1 SV=1 35 172 2.0E-35
sp|P63146|UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens GN=UBE2B PE=1 SV=1 35 172 2.0E-35
sp|Q32P99|UBE2B_BOVIN Ubiquitin-conjugating enzyme E2 B OS=Bos taurus GN=UBE2B PE=2 SV=1 35 172 2.0E-35
sp|P78717|UBC2_NECHA Ubiquitin-conjugating enzyme E2 2 OS=Nectria haematococca GN=UBC2 PE=3 SV=1 30 170 2.0E-35
sp|Q4PFA5|UBC2_USTMA Ubiquitin-conjugating enzyme E2 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UBC2 PE=3 SV=1 35 172 3.0E-35
sp|P25153|UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=Ubc6 PE=2 SV=2 35 172 5.0E-35
sp|Q9SLE4|UBC29_ARATH Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1 34 167 6.0E-35
sp|Q58FS2|UBC2_TRIHA Ubiquitin-conjugating enzyme E2 2 OS=Trichoderma harzianum GN=UBC2 PE=2 SV=1 30 170 7.0E-35
sp|P52478|UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans GN=ubc-1 PE=1 SV=1 35 170 9.0E-35
sp|P35134|UBC11_ARATH Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=1 SV=2 34 168 1.0E-34
sp|Q9FKT3|UBC30_ARATH Ubiquitin-conjugating enzyme E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1 34 168 1.0E-34
sp|P35135|UBC4_SOLLC Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1 34 168 2.0E-34
sp|P46595|UBC4_SCHPO Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc4 PE=1 SV=1 35 167 2.0E-34
sp|P62840|UB2D2_XENLA Ubiquitin-conjugating enzyme E2 D2 OS=Xenopus laevis GN=ube2d2 PE=1 SV=1 35 166 2.0E-34
sp|P62839|UB2D2_RAT Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norvegicus GN=Ube2d2 PE=1 SV=1 35 166 2.0E-34
sp|P62838|UB2D2_MOUSE Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus GN=Ube2d2 PE=1 SV=1 35 166 2.0E-34
sp|P62837|UB2D2_HUMAN Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens GN=UBE2D2 PE=1 SV=1 35 166 2.0E-34
sp|Q1RMX2|UB2D2_BOVIN Ubiquitin-conjugating enzyme E2 D2 OS=Bos taurus GN=UBE2D2 PE=2 SV=1 35 166 2.0E-34
sp|Q553F3|UBC2_DICDI Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium discoideum GN=ubc2 PE=3 SV=2 30 170 3.0E-34
sp|Q94F47|UBC28_ARATH Ubiquitin-conjugating enzyme E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1 34 168 3.0E-34
sp|P15732|UBC5_YEAST Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC5 PE=1 SV=1 32 167 3.0E-34
sp|P35132|UBC9_ARATH SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1 34 168 3.0E-34
sp|Q9Y2X8|UB2D4_HUMAN Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens GN=UBE2D4 PE=1 SV=1 35 166 4.0E-34
sp|P35133|UBC10_ARATH Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1 34 168 4.0E-34
sp|Q06AA9|UB2D2_PIG Ubiquitin-conjugating enzyme E2 D2 OS=Sus scrofa GN=UBE2D2 PE=2 SV=1 35 166 5.0E-34
sp|P61078|UB2D3_RAT Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norvegicus GN=Ube2d3 PE=2 SV=1 35 166 5.0E-34
sp|Q5R4V7|UB2D3_PONAB Ubiquitin-conjugating enzyme E2 D3 OS=Pongo abelii GN=UBE2D3 PE=2 SV=1 35 166 5.0E-34
sp|P61079|UB2D3_MOUSE Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus GN=Ube2d3 PE=1 SV=1 35 166 5.0E-34
sp|Q4R5N4|UB2D3_MACFA Ubiquitin-conjugating enzyme E2 D3 OS=Macaca fascicularis GN=UBE2D3 PE=2 SV=1 35 166 5.0E-34
sp|P61077|UB2D3_HUMAN Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens GN=UBE2D3 PE=1 SV=1 35 166 5.0E-34
sp|A5PKP9|UB2D4_XENLA Ubiquitin-conjugating enzyme E2 D4 OS=Xenopus laevis GN=ube2d4 PE=1 SV=1 35 166 6.0E-34
sp|Q8S919|UBC5B_ORYSJ Ubiquitin-conjugating enzyme E2 5B OS=Oryza sativa subsp. japonica GN=UBC5B PE=2 SV=1 34 168 1.0E-33
sp|P70711|U2D2B_RAT Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norvegicus GN=Ube2d2b PE=1 SV=1 35 166 2.0E-33
sp|Q6ZWY6|U2D2B_MOUSE Ubiquitin-conjugating enzyme E2 D2B OS=Mus musculus GN=Ube2d2b PE=1 SV=1 35 166 2.0E-33
sp|O13685|UBC13_SCHPO Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc13 PE=1 SV=1 32 168 3.0E-33
sp|O74196|UBC1_COLGL Ubiquitin-conjugating enzyme E2-16 kDa OS=Colletotrichum gloeosporioides GN=UBC1 PE=2 SV=1 35 167 3.0E-33
sp|P35129|UBC2_CAEEL Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditis elegans GN=let-70 PE=1 SV=1 35 166 3.0E-33
sp|Q6CUD9|UBC2_KLULA Ubiquitin-conjugating enzyme E2 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBC2 PE=3 SV=1 35 180 3.0E-33
sp|P35131|UBC8_ARATH Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1 34 167 4.0E-33
sp|P25867|UBCD1_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=eff PE=2 SV=1 35 166 4.0E-33
sp|P15731|UBC4_YEAST Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC4 PE=1 SV=1 32 167 5.0E-33
sp|Q9UVR2|UBC1_MAGO7 Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UBC1 PE=3 SV=2 35 168 6.0E-33
sp|Q3ZCF7|UB2D3_BOVIN Ubiquitin-conjugating enzyme E2 D3 OS=Bos taurus GN=UBE2D3 PE=2 SV=1 35 166 6.0E-33
sp|P06104|UBC2_YEAST Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD6 PE=1 SV=1 35 180 8.0E-33
sp|Q75EB8|UBC2_ASHGO Ubiquitin-conjugating enzyme E2 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UBC2 PE=3 SV=1 35 180 8.0E-33
sp|Q6FR76|UBC2_CANGA Ubiquitin-conjugating enzyme E2 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBC2 PE=3 SV=1 35 180 9.0E-33
sp|Q6BU36|UBC2_DEBHA Ubiquitin-conjugating enzyme E2 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UBC2 PE=3 SV=1 35 179 1.0E-32
sp|D3ZDK2|UB2D1_RAT Ubiquitin-conjugating enzyme E2 D1 OS=Rattus norvegicus GN=Ube2d1 PE=1 SV=1 35 166 1.0E-32
sp|P61080|UB2D1_MOUSE Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus GN=Ube2d1 PE=2 SV=1 35 166 1.0E-32
sp|P51668|UB2D1_HUMAN Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens GN=UBE2D1 PE=1 SV=1 35 166 1.0E-32
sp|Q2TA10|UB2D1_BOVIN Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus GN=UBE2D1 PE=2 SV=1 35 166 1.0E-32
sp|O74201|UBC2_CANAL Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBC2 PE=2 SV=1 35 179 1.0E-32
sp|P43102|UBC4_CANAX Ubiquitin-conjugating enzyme E2 4 OS=Candida albicans GN=UBC4 PE=2 SV=1 35 167 2.0E-32
sp|P0CS16|UBC2_CRYNJ Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UBC2 PE=3 SV=1 30 170 8.0E-32
sp|P0CS17|UBC2_CRYNB Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=UBC2 PE=3 SV=1 30 170 8.0E-32
sp|P52483|UB2E3_MOUSE Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus GN=Ube2e3 PE=1 SV=2 35 156 2.0E-31
sp|Q969T4|UB2E3_HUMAN Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens GN=UBE2E3 PE=1 SV=1 35 156 2.0E-31
sp|Q2T9X7|UB2E3_BOVIN Ubiquitin-conjugating enzyme E2 E3 OS=Bos taurus GN=UBE2E3 PE=2 SV=1 35 156 2.0E-31
sp|Q96LR5|UB2E2_HUMAN Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens GN=UBE2E2 PE=1 SV=1 35 156 1.0E-30
sp|Q91W82|UB2E2_MOUSE Ubiquitin-conjugating enzyme E2 E2 OS=Mus musculus GN=Ube2e2 PE=2 SV=1 35 156 1.0E-30
sp|Q02159|UBC7_YEAST Ubiquitin-conjugating enzyme E2 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC7 PE=1 SV=1 30 170 6.0E-30
sp|P52485|UBCD2_DROME Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophila melanogaster GN=Ubc2 PE=2 SV=1 35 165 7.0E-30
sp|P51965|UB2E1_HUMAN Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens GN=UBE2E1 PE=1 SV=1 35 156 1.0E-29
sp|P52482|UB2E1_MOUSE Ubiquitin-conjugating enzyme E2 E1 OS=Mus musculus GN=Ube2e1 PE=1 SV=1 35 156 1.0E-29
sp|Q9NPD8|UBE2T_HUMAN Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens GN=UBE2T PE=1 SV=1 36 151 2.0E-29
sp|Q5JXB2|UE2NL_HUMAN Putative ubiquitin-conjugating enzyme E2 N-like OS=Homo sapiens GN=UBE2NL PE=1 SV=1 36 159 3.0E-29
sp|Q9LJD7|COP10_ARATH Constitutive photomorphogenesis protein 10 OS=Arabidopsis thaliana GN=COP10 PE=1 SV=1 35 165 3.0E-29
sp|Q9C8X7|UBC31_ARATH Probable ubiquitin-conjugating enzyme E2 31 OS=Arabidopsis thaliana GN=UBC31 PE=2 SV=1 61 174 6.0E-29
sp|Q32LD2|UBE2T_BOVIN Ubiquitin-conjugating enzyme E2 T OS=Bos taurus GN=UBE2T PE=2 SV=2 34 168 1.0E-28
sp|P62255|UB2G1_RAT Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norvegicus GN=Ube2g1 PE=2 SV=3 37 179 2.0E-28
sp|P62254|UB2G1_MOUSE Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus GN=Ube2g1 PE=1 SV=3 37 179 2.0E-28
sp|P62253|UB2G1_HUMAN Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens GN=UBE2G1 PE=1 SV=3 37 179 2.0E-28
sp|Q9CQ37|UBE2T_MOUSE Ubiquitin-conjugating enzyme E2 T OS=Mus musculus GN=Ube2t PE=1 SV=1 36 151 2.0E-28
sp|Q4R5Y8|UB2G1_MACFA Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fascicularis GN=UBE2G1 PE=2 SV=1 37 179 3.0E-28
sp|O00102|UBC7_SCHPO Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc7 PE=2 SV=2 35 173 3.0E-28
sp|Q7ZY08|UBE2T_XENLA Ubiquitin-conjugating enzyme E2 T OS=Xenopus laevis GN=ube2t PE=2 SV=1 36 151 3.0E-28
sp|Q42540|UBC7_ARATH Ubiquitin-conjugating enzyme E2 7 OS=Arabidopsis thaliana GN=UBC7 PE=1 SV=1 48 179 7.0E-28
sp|Q8LGF7|PEX4_ARATH Protein PEROXIN-4 OS=Arabidopsis thaliana GN=PEX4 PE=1 SV=1 59 158 7.0E-28
sp|Q42541|UBC13_ARATH Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis thaliana GN=UBC13 PE=2 SV=1 48 179 1.0E-27
sp|Q941B6|UBC37_ARATH Probable ubiquitin-conjugating enzyme E2 37 OS=Arabidopsis thaliana GN=UBC37 PE=2 SV=2 36 170 1.0E-27
sp|Q08BH7|UBE2T_DANRE Ubiquitin-conjugating enzyme E2 T OS=Danio rerio GN=ube2t PE=2 SV=1 36 151 2.0E-27
sp|Q9FI61|UBC27_ARATH Ubiquitin-conjugating enzyme E2 27 OS=Arabidopsis thaliana GN=UBC27 PE=2 SV=1 36 166 5.0E-27
sp|P42747|UBC14_ARATH Ubiquitin-conjugating enzyme E2 14 OS=Arabidopsis thaliana GN=UBC14 PE=1 SV=1 48 179 6.0E-27
sp|P34477|UBC7_CAEEL Probable ubiquitin-conjugating enzyme E2 7 OS=Caenorhabditis elegans GN=ubc-7 PE=1 SV=1 37 180 7.0E-27
sp|Q6FVQ8|UBC12_CANGA NEDD8-conjugating enzyme UBC12 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBC12 PE=3 SV=1 36 170 9.0E-27
sp|Q86IZ3|UBCX_DICDI Ubiquitin-conjugating enzyme E2 pex4 OS=Dictyostelium discoideum GN=pex4 PE=3 SV=1 36 158 2.0E-26
sp|Q17QG5|UB2G2_BOVIN Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus GN=UBE2G2 PE=2 SV=1 32 166 2.0E-26
sp|Q5RF84|UB2G2_PONAB Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii GN=UBE2G2 PE=2 SV=1 32 166 2.0E-26
sp|P60605|UB2G2_MOUSE Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus GN=Ube2g2 PE=1 SV=1 32 166 2.0E-26
sp|P60604|UB2G2_HUMAN Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens GN=UBE2G2 PE=1 SV=1 32 166 2.0E-26
sp|P25868|UBC7_WHEAT Ubiquitin-conjugating enzyme E2 7 OS=Triticum aestivum GN=UBC7 PE=2 SV=1 46 179 6.0E-26
sp|Q9P6I1|UBC16_SCHPO Ubiquitin-conjugating enzyme E2 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc16 PE=3 SV=2 32 158 8.0E-26
sp|P40984|UBC9_SCHPO SUMO-conjugating enzyme ubc9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hus5 PE=1 SV=1 36 176 1.0E-25
sp|Q16763|UBE2S_HUMAN Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens GN=UBE2S PE=1 SV=2 33 179 2.0E-25
sp|Q6C9W0|UBC12_YARLI NEDD8-conjugating enzyme UBC12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBC12 PE=3 SV=1 17 170 5.0E-25
sp|Q1RML1|UBE2S_BOVIN Ubiquitin-conjugating enzyme E2 S OS=Bos taurus GN=UBE2S PE=2 SV=2 33 179 5.0E-25
sp|O74810|UBC1_SCHPO Ubiquitin-conjugating enzyme E2 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc1 PE=3 SV=2 30 166 5.0E-25
sp|Q9VSF3|UBC12_DROME Nedd8-conjugating enzyme Ubc12 OS=Drosophila melanogaster GN=Ubc12 PE=1 SV=1 15 175 6.0E-25
sp|Q8AVU2|UB2SB_XENLA Ubiquitin-conjugating enzyme E2 S-B OS=Xenopus laevis GN=ube2s-b PE=2 SV=1 33 169 7.0E-25
sp|B5DFI8|UBE2S_RAT Ubiquitin-conjugating enzyme E2 S OS=Rattus norvegicus GN=Ube2s PE=2 SV=1 33 179 8.0E-25
sp|A7SE05|UBE2S_NEMVE Ubiquitin-conjugating enzyme E2 S OS=Nematostella vectensis GN=v1g237158 PE=3 SV=1 30 158 1.0E-24
sp|Q4V908|UBE2S_DANRE Ubiquitin-conjugating enzyme E2 S OS=Danio rerio GN=ube2s PE=2 SV=1 33 169 1.0E-24
sp|Q921J4|UBE2S_MOUSE Ubiquitin-conjugating enzyme E2 S OS=Mus musculus GN=Ube2s PE=1 SV=1 33 179 1.0E-24
sp|A1L3K1|UB2SA_XENLA Ubiquitin-conjugating enzyme E2 S-A OS=Xenopus laevis GN=ube2s-a PE=2 SV=1 33 179 1.0E-24
sp|Q9ZU75|UB12L_ARATH Probable NEDD8-conjugating enzyme Ubc12-like OS=Arabidopsis thaliana GN=RCE2 PE=2 SV=1 36 170 2.0E-24
sp|Q9Y818|UBC15_SCHPO Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc15 PE=3 SV=1 30 166 2.0E-24
sp|Q28F89|UBE2S_XENTR Ubiquitin-conjugating enzyme E2 S OS=Xenopus tropicalis GN=ube2s PE=2 SV=1 33 169 2.0E-24
sp|C1C3R6|UBE2S_LITCT Ubiquitin-conjugating enzyme E2 S OS=Lithobates catesbeiana GN=ube2s PE=2 SV=1 33 169 3.0E-24
sp|Q9SDY5|RCE1_ARATH NEDD8-conjugating enzyme Ubc12 OS=Arabidopsis thaliana GN=RCE1 PE=1 SV=1 36 170 3.0E-24
sp|Q8CFI2|UB2R1_MOUSE Ubiquitin-conjugating enzyme E2 R1 OS=Mus musculus GN=Cdc34 PE=1 SV=1 32 161 4.0E-24
sp|Q76EZ2|UB2SC_XENLA Ubiquitin-conjugating enzyme E2 S-C OS=Xenopus laevis GN=ube2s-c PE=2 SV=1 33 169 4.0E-24
sp|P0C8G3|UBC_ASFK5 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=UBC PE=2 SV=1 33 161 5.0E-24
sp|P49427|UB2R1_HUMAN Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens GN=CDC34 PE=1 SV=2 32 161 5.0E-24
sp|P68037|UB2L3_MOUSE Ubiquitin-conjugating enzyme E2 L3 OS=Mus musculus GN=Ube2l3 PE=1 SV=1 32 166 5.0E-24
sp|P68036|UB2L3_HUMAN Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens GN=UBE2L3 PE=1 SV=1 32 166 5.0E-24
sp|Q3MHP1|UB2L3_BOVIN Ubiquitin-conjugating enzyme E2 L3 OS=Bos taurus GN=UBE2L3 PE=2 SV=1 32 166 5.0E-24
sp|Q5R5I4|UB2L3_PONAB Ubiquitin-conjugating enzyme E2 L3 OS=Pongo abelii GN=UBE2L3 PE=2 SV=1 32 166 6.0E-24
sp|P52487|UBC84_DROME Ubiquitin-conjugating enzyme E2-18 kDa OS=Drosophila melanogaster GN=Ubc84D PE=2 SV=2 32 166 8.0E-24
sp|Q9P7R4|UBC8_SCHPO Ubiquitin-conjugating enzyme E2 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc8 PE=3 SV=1 35 179 1.0E-23
sp|Q9W6H5|UBC9A_DANRE SUMO-conjugating enzyme UBC9-A OS=Danio rerio GN=ube2ia PE=1 SV=1 56 177 2.0E-23
sp|Q9DDJ0|UBC9B_DANRE SUMO-conjugating enzyme UBC9-B OS=Danio rerio GN=ube2ib PE=1 SV=1 56 177 2.0E-23
sp|Q28CQ4|UBC9_XENTR SUMO-conjugating enzyme UBC9 OS=Xenopus tropicalis GN=ube2i PE=2 SV=1 56 177 2.0E-23
sp|P63282|UBC9_XENLA SUMO-conjugating enzyme UBC9 OS=Xenopus laevis GN=ube2i PE=1 SV=1 56 177 2.0E-23
sp|P63281|UBC9_RAT SUMO-conjugating enzyme UBC9 OS=Rattus norvegicus GN=Ube2i PE=1 SV=1 56 177 2.0E-23
sp|P63280|UBC9_MOUSE SUMO-conjugating enzyme UBC9 OS=Mus musculus GN=Ube2i PE=1 SV=1 56 177 2.0E-23
sp|Q2EF73|UBC9_ICTTR SUMO-conjugating enzyme UBC9 OS=Ictidomys tridecemlineatus GN=UBE2I PE=1 SV=1 56 177 2.0E-23
sp|P63279|UBC9_HUMAN SUMO-conjugating enzyme UBC9 OS=Homo sapiens GN=UBE2I PE=1 SV=1 56 177 2.0E-23
sp|P63283|UBC9_CHICK SUMO-conjugating enzyme UBC9 OS=Gallus gallus GN=UBE2I PE=1 SV=1 56 177 2.0E-23
sp|O14933|UB2L6_HUMAN Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Homo sapiens GN=UBE2L6 PE=1 SV=4 36 167 2.0E-23
sp|Q94490|UBCB_DICDI Ubiquitin conjugating enzyme E2 B OS=Dictyostelium discoideum GN=ubcB PE=1 SV=1 35 166 2.0E-23
sp|P28263|UBC8_YEAST Ubiquitin-conjugating enzyme E2-24 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC8 PE=1 SV=2 32 170 2.0E-23
sp|P0C8G4|UBC_ASFP4 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=UBC PE=2 SV=1 33 161 2.0E-23
sp|P21734|UBC1_YEAST Ubiquitin-conjugating enzyme E2 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC1 PE=1 SV=1 32 172 3.0E-23
sp|P52484|UBC21_CAEEL Probable ubiquitin-conjugating enzyme E2 21 OS=Caenorhabditis elegans GN=ubc-21 PE=3 SV=3 59 157 6.0E-23
sp|Q29503|UB2R2_RABIT Ubiquitin-conjugating enzyme E2 R2 OS=Oryctolagus cuniculus GN=UBE2R2 PE=2 SV=1 32 161 1.0E-22
sp|Q6ZWZ2|UB2R2_MOUSE Ubiquitin-conjugating enzyme E2 R2 OS=Mus musculus GN=Ube2r2 PE=1 SV=1 32 161 1.0E-22
sp|Q712K3|UB2R2_HUMAN Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens GN=UBE2R2 PE=1 SV=1 32 161 1.0E-22
sp|P27949|UBC_ASFB7 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=UBC PE=2 SV=1 33 161 1.0E-22
sp|Q6Y1Z4|UBC9_PAGMA SUMO-conjugating enzyme UBC9 OS=Pagrus major GN=ube2i PE=2 SV=1 51 175 1.0E-22
sp|Q9UTN8|UBC14_SCHPO Ubiquitin-conjugating enzyme E2 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc14 PE=3 SV=1 37 166 1.0E-22
sp|O74549|UBC12_SCHPO NEDD8-conjugating enzyme ubc12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc12 PE=3 SV=1 72 170 1.0E-22
sp|P0C8G5|UBC_ASFWA Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=UBC PE=2 SV=1 33 161 2.0E-22
sp|P25869|UBC_ASFM2 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=UBC PE=2 SV=1 33 161 2.0E-22
sp|Q54I43|UBE2S_DICDI Ubiquitin-conjugating enzyme E2 S OS=Dictyostelium discoideum GN=ube2s PE=3 SV=1 33 158 3.0E-22
sp|Q54TI6|UBC12_DICDI NEDD8-conjugating enzyme Ubc12 OS=Dictyostelium discoideum GN=ube2m PE=3 SV=1 45 170 4.0E-22
sp|Q6CSW8|UBC12_KLULA NEDD8-conjugating enzyme UBC12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBC12 PE=3 SV=1 72 170 4.0E-22
sp|Q6DCZ9|UBC12_XENLA NEDD8-conjugating enzyme Ubc12 OS=Xenopus laevis GN=ube2m PE=2 SV=1 36 175 8.0E-22
sp|C3Z724|UBE2S_BRAFL Ubiquitin-conjugating enzyme E2 S OS=Branchiostoma floridae GN=BRAFLDRAFT_259979 PE=3 SV=1 30 158 8.0E-22
sp|P42749|UBC5_ARATH Ubiquitin-conjugating enzyme E2 5 OS=Arabidopsis thaliana GN=UBC5 PE=2 SV=2 32 170 9.0E-22
sp|P42748|UBC4_ARATH Ubiquitin-conjugating enzyme E2 4 OS=Arabidopsis thaliana GN=UBC4 PE=2 SV=2 32 170 1.0E-21
sp|P16577|UBC4_WHEAT Ubiquitin-conjugating enzyme E2-23 kDa OS=Triticum aestivum GN=UBC4 PE=1 SV=1 34 170 1.0E-21
sp|Q6P8D9|UBC12_XENTR NEDD8-conjugating enzyme Ubc12 OS=Xenopus tropicalis GN=ube2m PE=2 SV=1 36 175 1.0E-21
sp|O09181|UBC9_MESAU SUMO-conjugating enzyme UBC9 OS=Mesocricetus auratus GN=UBE2I PE=2 SV=1 56 177 2.0E-21
sp|P61082|UBC12_MOUSE NEDD8-conjugating enzyme Ubc12 OS=Mus musculus GN=Ube2m PE=1 SV=1 36 175 4.0E-21
sp|P61081|UBC12_HUMAN NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens GN=UBE2M PE=1 SV=1 36 175 4.0E-21
sp|A3KN22|UBC12_BOVIN NEDD8-conjugating enzyme Ubc12 OS=Bos taurus GN=UBE2M PE=2 SV=1 36 175 4.0E-21
sp|Q75AF2|UBC12_ASHGO NEDD8-conjugating enzyme UBC12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UBC12 PE=3 SV=2 72 172 4.0E-21
sp|A5PJC4|UB2L6_BOVIN Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Bos taurus GN=UBE2L6 PE=2 SV=1 32 166 6.0E-21
sp|P42750|UBC6_ARATH Ubiquitin-conjugating enzyme E2 6 OS=Arabidopsis thaliana GN=UBC6 PE=2 SV=2 32 170 6.0E-21
sp|B3NWW9|UBE2S_DROER Ubiquitin-conjugating enzyme E2 S OS=Drosophila erecta GN=GG18165 PE=3 SV=1 35 158 8.0E-21
sp|Q95LM1|UBE2U_MACFA Ubiquitin-conjugating enzyme E2 U OS=Macaca fascicularis GN=UBE2U PE=2 SV=1 37 167 9.0E-21
sp|B4Q2J2|UBE2S_DROYA Ubiquitin-conjugating enzyme E2 S OS=Drosophila yakuba GN=GE15576 PE=3 SV=1 35 158 9.0E-21
sp|P62257|UBE2H_MOUSE Ubiquitin-conjugating enzyme E2 H OS=Mus musculus GN=Ube2h PE=1 SV=1 35 170 1.0E-20
sp|P62256|UBE2H_HUMAN Ubiquitin-conjugating enzyme E2 H OS=Homo sapiens GN=UBE2H PE=1 SV=1 35 170 1.0E-20
sp|Q32LN1|UBE2H_BOVIN Ubiquitin-conjugating enzyme E2 H OS=Bos taurus GN=UBE2H PE=2 SV=1 35 170 1.0E-20
sp|B3MQV3|UBE2S_DROAN Ubiquitin-conjugating enzyme E2 S OS=Drosophila ananassae GN=GF21161 PE=3 SV=1 35 158 1.0E-20
sp|B4R6G1|UBE2S_DROSI Ubiquitin-conjugating enzyme E2 S OS=Drosophila simulans GN=GD17343 PE=3 SV=1 35 158 1.0E-20
sp|B4IF39|UBE2S_DROSE Ubiquitin-conjugating enzyme E2 S OS=Drosophila sechellia GN=GM13299 PE=3 SV=1 35 158 1.0E-20
sp|Q9VX25|UBE2S_DROME Ubiquitin-conjugating enzyme E2 S OS=Drosophila melanogaster GN=CG8188 PE=1 SV=2 35 158 1.0E-20
sp|Q55EY8|UBE2W_DICDI Probable ubiquitin-conjugating enzyme E2 W OS=Dictyostelium discoideum GN=ube2w PE=3 SV=1 35 167 2.0E-20
sp|Q9QZU9|UB2L6_MOUSE Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Mus musculus GN=Ube2l6 PE=1 SV=3 34 169 2.0E-20
sp|P14682|UBC3_YEAST Ubiquitin-conjugating enzyme E2-34 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC34 PE=1 SV=1 45 170 2.0E-20
sp|Q4V8J2|UB2L6_RAT Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Rattus norvegicus GN=Ube2l6 PE=2 SV=1 32 169 2.0E-20
sp|B5DKM4|UBE2S_DROPS Ubiquitin-conjugating enzyme E2 S OS=Drosophila pseudoobscura pseudoobscura GN=GA22810 PE=3 SV=1 35 158 3.0E-20
sp|B4H9W2|UBE2S_DROPE Ubiquitin-conjugating enzyme E2 S OS=Drosophila persimilis GN=GL16001 PE=3 SV=1 35 158 3.0E-20
sp|Q8SSK3|Y1A1_ENCCU Probable ubiquitin-conjugating enzyme E2 ECU01_1010 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_1010 PE=1 SV=1 27 180 3.0E-20
sp|B4L7V4|UBE2S_DROMO Ubiquitin-conjugating enzyme E2 S OS=Drosophila mojavensis GN=GI11085 PE=3 SV=1 35 158 3.0E-20
sp|B4MA02|UBE2S_DROVI Ubiquitin-conjugating enzyme E2 S OS=Drosophila virilis GN=GJ15767 PE=3 SV=1 35 158 5.0E-20
sp|Q5VVX9|UBE2U_HUMAN Ubiquitin-conjugating enzyme E2 U OS=Homo sapiens GN=UBE2U PE=1 SV=1 37 167 6.0E-20
sp|Q1JPX4|UB2WB_DANRE Probable ubiquitin-conjugating enzyme E2 W-B OS=Danio rerio GN=ube2wb PE=2 SV=1 32 167 8.0E-20
sp|B4N208|UBE2S_DROWI Ubiquitin-conjugating enzyme E2 S OS=Drosophila willistoni GN=GK16201 PE=3 SV=1 35 158 9.0E-20
sp|Q9FF66|UBC22_ARATH Ubiquitin-conjugating enzyme E2 22 OS=Arabidopsis thaliana GN=UBC22 PE=1 SV=1 32 174 1.0E-19
sp|B4JKB7|UBE2S_DROGR Ubiquitin-conjugating enzyme E2 S OS=Drosophila grimshawi GN=GH12079 PE=3 SV=1 35 158 1.0E-19
sp|Q5UQC9|UBC1_MIMIV Probable ubiquitin-conjugating enzyme E2 L460 OS=Acanthamoeba polyphaga mimivirus GN=UBC PE=3 SV=1 32 170 2.0E-19
sp|Q8VDW4|UBE2W_MOUSE Ubiquitin-conjugating enzyme E2 W OS=Mus musculus GN=Ube2w PE=1 SV=1 32 167 2.0E-19
sp|Q28FC1|UBE2W_XENTR Ubiquitin-conjugating enzyme E2 W OS=Xenopus tropicalis GN=ube2w PE=2 SV=1 32 167 3.0E-19
sp|B5DEI4|UBE2W_RAT Ubiquitin-conjugating enzyme E2 W OS=Rattus norvegicus GN=Ube2w PE=2 SV=1 32 167 3.0E-19
sp|Q96B02|UBE2W_HUMAN Ubiquitin-conjugating enzyme E2 W OS=Homo sapiens GN=UBE2W PE=1 SV=1 32 167 3.0E-19
sp|A6H795|UBE2W_BOVIN Ubiquitin-conjugating enzyme E2 W OS=Bos taurus GN=UBE2W PE=2 SV=1 32 167 3.0E-19
sp|P52491|UBC12_YEAST NEDD8-conjugating enzyme UBC12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC12 PE=1 SV=1 17 170 4.0E-19
sp|O60015|UBCX_PICAN Ubiquitin-conjugating enzyme E2-21 kDa OS=Pichia angusta GN=PEX4 PE=3 SV=1 52 162 4.0E-19
sp|Q95017|UBC9_CAEEL SUMO-conjugating enzyme UBC9 OS=Caenorhabditis elegans GN=ubc-9 PE=1 SV=1 57 170 5.0E-19
sp|Q4VBH4|UB2WA_DANRE Probable ubiquitin-conjugating enzyme E2 W-A OS=Danio rerio GN=ube2wa PE=2 SV=2 32 167 9.0E-19
sp|P50623|UBC9_YEAST SUMO-conjugating enzyme UBC9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC9 PE=1 SV=1 30 175 2.0E-18
sp|Q42551|SCE1_ARATH SUMO-conjugating enzyme SCE1 OS=Arabidopsis thaliana GN=SCE1 PE=1 SV=1 61 170 3.0E-18
sp|P61087|UBE2K_MOUSE Ubiquitin-conjugating enzyme E2 K OS=Mus musculus GN=Ube2k PE=1 SV=3 34 167 1.0E-17
sp|P61086|UBE2K_HUMAN Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens GN=UBE2K PE=1 SV=3 34 167 1.0E-17
sp|P61085|UBE2K_BOVIN Ubiquitin-conjugating enzyme E2 K OS=Bos taurus GN=UBE2K PE=1 SV=3 34 167 1.0E-17
sp|Q9NGP4|UBC9_DICDI Sumo-conjugating enzyme ubc9 OS=Dictyostelium discoideum GN=ubc9 PE=3 SV=1 36 175 3.0E-16
sp|O23239|UBC17_ARATH Probable ubiquitin-conjugating enzyme E2 17 OS=Arabidopsis thaliana GN=UBC17 PE=2 SV=1 34 135 4.0E-16
sp|P33296|UBC6_YEAST Ubiquitin-conjugating enzyme E2 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC6 PE=1 SV=1 35 142 4.0E-16
sp|P52486|UBCD4_DROME Ubiquitin-conjugating enzyme E2-22 kDa OS=Drosophila melanogaster GN=Ubc4 PE=1 SV=2 64 134 1.0E-15
sp|Q5M8Y2|UBE2F_XENTR NEDD8-conjugating enzyme UBE2F OS=Xenopus tropicalis GN=ube2f PE=2 SV=1 32 170 4.0E-15
sp|Q6IRC7|UBE2F_XENLA NEDD8-conjugating enzyme UBE2F OS=Xenopus laevis GN=ube2f PE=2 SV=1 32 170 4.0E-15
sp|Q6FQK7|UBC6_CANGA Ubiquitin-conjugating enzyme E2 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBC6 PE=3 SV=1 35 142 7.0E-15
sp|Q3UE37|UBE2Z_MOUSE Ubiquitin-conjugating enzyme E2 Z OS=Mus musculus GN=Ube2z PE=1 SV=2 18 178 8.0E-15
sp|Q9H832|UBE2Z_HUMAN Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens GN=UBE2Z PE=1 SV=2 18 178 9.0E-15
sp|Q3B7D1|UBE2Z_RAT Ubiquitin-conjugating enzyme E2 Z OS=Rattus norvegicus GN=Ube2z PE=1 SV=2 18 178 1.0E-14
sp|P29340|UBCX_YEAST Ubiquitin-conjugating enzyme E2-21 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX4 PE=1 SV=1 45 158 1.0E-14
sp|Q2TA03|UB2J2_BOVIN Ubiquitin-conjugating enzyme E2 J2 OS=Bos taurus GN=UBE2J2 PE=2 SV=1 22 144 1.0E-14
sp|Q6DG60|UBE2Z_DANRE Ubiquitin-conjugating enzyme E2 Z OS=Danio rerio GN=ube2z PE=2 SV=2 30 168 1.0E-14
sp|P42743|UBC15_ARATH Ubiquitin-conjugating enzyme 15 OS=Arabidopsis thaliana GN=UBC15 PE=2 SV=2 36 135 2.0E-14
sp|P49428|UBCX_PICPA Ubiquitin-conjugating enzyme E2-24 kDa OS=Komagataella pastoris GN=PEX4 PE=1 SV=1 56 180 2.0E-14
sp|Q6P073|UB2J2_MOUSE Ubiquitin-conjugating enzyme E2 J2 OS=Mus musculus GN=Ube2j2 PE=1 SV=1 22 144 2.0E-14
sp|Q8N2K1|UB2J2_HUMAN Ubiquitin-conjugating enzyme E2 J2 OS=Homo sapiens GN=UBE2J2 PE=1 SV=3 32 144 4.0E-14
sp|Q6NY82|UBE2F_DANRE NEDD8-conjugating enzyme UBE2F OS=Danio rerio GN=ube2f PE=2 SV=1 23 170 4.0E-14
sp|Q5ZKX6|UBE2F_CHICK NEDD8-conjugating enzyme UBE2F OS=Gallus gallus GN=UBE2F PE=2 SV=1 32 170 4.0E-14
sp|Q1RMW1|UBE2F_BOVIN NEDD8-conjugating enzyme UBE2F OS=Bos taurus GN=UBE2F PE=2 SV=1 32 170 4.0E-14
sp|Q969M7|UBE2F_HUMAN NEDD8-conjugating enzyme UBE2F OS=Homo sapiens GN=UBE2F PE=1 SV=1 21 170 5.0E-14
sp|Q9FWT2|UBC16_ARATH Probable ubiquitin-conjugating enzyme E2 16 OS=Arabidopsis thaliana GN=UBC16 PE=2 SV=1 34 135 6.0E-14
sp|Q66KB0|UBE2Z_XENTR Ubiquitin-conjugating enzyme E2 Z OS=Xenopus tropicalis GN=ube2z PE=2 SV=2 30 144 7.0E-14
sp|Q74Z34|UBC6_ASHGO Ubiquitin-conjugating enzyme E2 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UBC6 PE=3 SV=1 30 142 8.0E-14
sp|Q5UQ40|UBC4_MIMIV Probable bifunctional E2/E3 enzyme R795 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R795 PE=3 SV=1 36 176 1.0E-13
sp|Q9FMM0|UBC18_ARATH Probable ubiquitin-conjugating enzyme E2 18 OS=Arabidopsis thaliana GN=UBC18 PE=2 SV=1 36 135 1.0E-13
sp|Q5U203|UBE2F_RAT NEDD8-conjugating enzyme UBE2F OS=Rattus norvegicus GN=Ube2f PE=2 SV=2 21 170 1.0E-13
sp|Q9CY34|UB2FA_MOUSE NEDD8-conjugating enzyme UBE2F OS=Mus musculus GN=Ube2f PE=1 SV=1 21 170 1.0E-13
sp|Q6PCF7|UBE2Z_XENLA Ubiquitin-conjugating enzyme E2 Z OS=Xenopus laevis GN=ube2z PE=2 SV=2 36 144 1.0E-13
sp|O42646|UBC6_SCHPO Ubiquitin-conjugating enzyme E2 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc6 PE=2 SV=1 30 142 2.0E-13
sp|Q3UWQ3|UB2FB_MOUSE NEDD8-conjugating enzyme UBE2F-B OS=Mus musculus GN=Ube2fb PE=2 SV=1 35 170 2.0E-13
sp|Q6CMG6|UBC6_KLULA Ubiquitin-conjugating enzyme E2 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBC6 PE=3 SV=1 30 142 4.0E-13
sp|Q7ZYX1|AKTIP_DANRE AKT-interacting protein OS=Danio rerio GN=aktip PE=2 SV=1 11 171 9.0E-13
sp|Q6BYG4|UBC6_DEBHA Ubiquitin-conjugating enzyme E2 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UBC6 PE=3 SV=2 30 142 2.0E-12
sp|Q11076|UBC17_CAEEL Probable ubiquitin-conjugating enzyme protein 17 OS=Caenorhabditis elegans GN=ubc-17 PE=3 SV=3 69 142 5.0E-12
sp|Q5XGV8|AKTPB_XENLA AKT-interacting protein homolog B OS=Xenopus laevis GN=aktip-b PE=2 SV=1 11 171 5.0E-12
sp|B5X1G6|AKTIP_SALSA AKT-interacting protein OS=Salmo salar GN=aktip PE=2 SV=1 11 171 1.0E-11
sp|Q9XVK5|UBC12_CAEEL NEDD8-conjugating enzyme ubc-12 OS=Caenorhabditis elegans GN=ubc-12 PE=2 SV=1 72 170 2.0E-11
sp|Q54LP7|UB2J2_DICDI Ubiquitin-conjugating enzyme E2 J2 OS=Dictyostelium discoideum GN=ube2j2 PE=1 SV=1 36 148 2.0E-11
sp|Q498F8|AKTPA_XENLA AKT-interacting protein homolog A OS=Xenopus laevis GN=aktip-a PE=2 SV=1 15 171 3.0E-11
sp|Q9FK29|UBC33_ARATH Probable ubiquitin-conjugating enzyme E2 33 OS=Arabidopsis thaliana GN=UBC33 PE=2 SV=1 32 142 6.0E-11
sp|Q9SHI7|UBC34_ARATH Ubiquitin-conjugating enzyme E2 34 OS=Arabidopsis thaliana GN=UBC34 PE=2 SV=1 32 153 9.0E-11
sp|Q28IA3|AKTIP_XENTR AKT-interacting protein OS=Xenopus tropicalis GN=aktip PE=2 SV=1 15 171 1.0E-10
sp|Q4R5E1|AKTIP_MACFA AKT-interacting protein OS=Macaca fascicularis GN=AKTIP PE=2 SV=1 18 171 3.0E-10
sp|Q9H8T0|AKTIP_HUMAN AKT-interacting protein OS=Homo sapiens GN=AKTIP PE=1 SV=1 18 171 3.0E-10
sp|Q5FVH4|AKTIP_RAT AKT-interacting protein OS=Rattus norvegicus GN=Aktip PE=1 SV=1 37 171 3.0E-10
sp|Q5RE48|AKTIP_PONAB AKT-interacting protein OS=Pongo abelii GN=AKTIP PE=2 SV=1 18 171 3.0E-10
sp|Q9LSP7|UBC32_ARATH Ubiquitin-conjugating enzyme E2 32 OS=Arabidopsis thaliana GN=UBC32 PE=2 SV=1 25 148 3.0E-10
sp|Q5ZJJ5|AKTIP_CHICK AKT-interacting protein OS=Gallus gallus GN=AKTIP PE=2 SV=1 37 171 5.0E-10
sp|Q64362|AKTIP_MOUSE AKT-interacting protein OS=Mus musculus GN=Aktip PE=1 SV=1 37 171 5.0E-10
sp|Q8IWF7|U2D2L_HUMAN Putative ubiquitin-conjugating enzyme E2 D2-like protein OS=Homo sapiens GN=UBE2DNL PE=5 SV=1 35 107 2.0E-09
sp|Q54AK6|UB2JL_DICDI Ubiquitin-conjugating enzyme E2 J2-like OS=Dictyostelium discoideum GN=DDB_G0294380 PE=3 SV=1 28 120 1.0E-08
sp|Q9Y385|UB2J1_HUMAN Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens GN=UBE2J1 PE=1 SV=2 33 156 2.0E-08
sp|Q9NR09|BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens GN=BIRC6 PE=1 SV=2 69 142 2.0E-08
sp|Q9JJZ4|UB2J1_MOUSE Ubiquitin-conjugating enzyme E2 J1 OS=Mus musculus GN=Ube2j1 PE=1 SV=2 33 156 2.0E-08
sp|O88738|BIRC6_MOUSE Baculoviral IAP repeat-containing protein 6 OS=Mus musculus GN=Birc6 PE=1 SV=2 69 142 2.0E-08
sp|A7RRG3|AKTIP_NEMVE Protein AKTIP homolog OS=Nematostella vectensis GN=v1g232160 PE=3 SV=1 37 170 1.0E-07
sp|O45495|UB2V1_CAEEL Ubiquitin-conjugating enzyme E2 variant 1 OS=Caenorhabditis elegans GN=uev-1 PE=1 SV=1 58 135 1.0E-07
sp|O74983|MMS2_SCHPO Ubiquitin-conjugating enzyme spm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spm2 PE=1 SV=1 54 147 7.0E-07
sp|P53152|MMS2_YEAST Ubiquitin-conjugating enzyme variant MMS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMS2 PE=1 SV=1 57 155 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1338
MDYSMEDNQNSAPGSVQAAKLNGARKGPDSHSVTKRLQTELMQLMTSPTPGISAFPSADGNMLSWTATIQGPDDT
PYAGLTFKLGFVFPSNYPYAPPAVLFKTPIYHPNVDFSGRICLDILKDKWTPAYNIQTVLLSLQSLLGEPNNASP
LNGEAAELWDKDPQEFKNKVVARHRDIEEE*
Coding >Hirsu2|1338
ATGGATTATTCCATGGAGGACAACCAGAACTCGGCTCCAGGCAGCGTCCAAGCCGCCAAACTCAATGGCGCCCGC
AAGGGCCCGGACTCGCACAGCGTCACCAAGAGGCTGCAGACGGAGCTGATGCAGCTCATGACGTCGCCCACGCCC
GGCATCTCGGCCTTCCCCTCGGCCGACGGCAACATGCTGTCCTGGACCGCCACCATCCAGGGCCCCGACGACACC
CCCTACGCCGGCCTCACCTTCAAGCTCGGCTTCGTCTTCCCCTCCAACTATCCCTACGCGCCCCCGGCCGTCCTC
TTCAAGACGCCCATCTACCACCCCAACGTCGACTTCTCCGGCCGCATCTGCCTCGACATCCTCAAGGACAAGTGG
ACGCCCGCCTACAACATCCAGACCGTCCTGCTGAGCCTGCAGAGCTTGCTCGGCGAGCCCAACAATGCGTCTCCT
CTGAACGGCGAGGCCGCCGAGCTGTGGGACAAGGACCCGCAAGAGTTCAAGAACAAGGTCGTCGCACGCCACAGG
GACATTGAGGAAGAGTAG
Transcript >Hirsu2|1338
ATGGATTATTCCATGGAGGACAACCAGAACTCGGCTCCAGGCAGCGTCCAAGCCGCCAAACTCAATGGCGCCCGC
AAGGGCCCGGACTCGCACAGCGTCACCAAGAGGCTGCAGACGGAGCTGATGCAGCTCATGACGTCGCCCACGCCC
GGCATCTCGGCCTTCCCCTCGGCCGACGGCAACATGCTGTCCTGGACCGCCACCATCCAGGGCCCCGACGACACC
CCCTACGCCGGCCTCACCTTCAAGCTCGGCTTCGTCTTCCCCTCCAACTATCCCTACGCGCCCCCGGCCGTCCTC
TTCAAGACGCCCATCTACCACCCCAACGTCGACTTCTCCGGCCGCATCTGCCTCGACATCCTCAAGGACAAGTGG
ACGCCCGCCTACAACATCCAGACCGTCCTGCTGAGCCTGCAGAGCTTGCTCGGCGAGCCCAACAATGCGTCTCCT
CTGAACGGCGAGGCCGCCGAGCTGTGGGACAAGGACCCGCAAGAGTTCAAGAACAAGGTCGTCGCACGCCACAGG
GACATTGAGGAAGAGTAG
Gene >Hirsu2|1338
ATGGATTATTCCATGGAGGACAACCAGAACTCGGCTCCAGGCAGCGTCCAAGCCGCCAAACTCAATGGCGCCCGC
AAGGGCCCGGACTCGCACAGCGTCACCAAGAGGTCGGTAAACAGCCCGCCTCGTGCTCGTCGCCGCGCTGACCGC
GTCGCCGTCGCCGCAGGCTGCAGACGGAGCTGATGCAGCTCATGACGTCGCCCACGCCCGGCATCTCGGCCTTCC
CCTCGGCCGACGGCAACATGCTGTCCTGGACCGCCACCATCCAGGGCCCCGACGACACCCCCTACGCCGGCCTCA
CCTTCAAGCTCGGCTTCGTCTTCCCCTCCAACTATCCCTACGCGCCCCCGGCCGTCCTCTTCAAGACGCCCATCT
ACCACCCCAACGTCGACTTCTCCGGCCGCATCTGCCTCGACATCCTCAAGGACAAGTGGACGCCCGCCTACAACA
TCCAGACCGTCCTGCTGAGCCTGCAGAGCTTGCTCGGCGAGCCCAACAAGTCTGTCCACTCCCTTCCTCCCCTCC
CCCTCGTCACGCGGATCGCGCCCGCTCTGTCCGCTTGCTCGCCCGCCGAGACCCCTGGCTGACGCGTCGGCAGTG
CGTCTCCTCTGAACGGCGAGGCCGCCGAGCTGTGGGACAAGGACCCGCAAGAGTTCAAGAACAAGGTCGTCGCAC
GCCACAGGGACATTGAGGAAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail