Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1335
Gene name
LocationContig_1292:5793..7501
Strand+
Gene length (bp)1708
Transcript length (bp)1494
Coding sequence length (bp)1494
Protein length (aa) 498

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13454 NAD_binding_9 FAD-NAD(P)-binding 4.5E-11 7 150
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 9.9E-10 3 210
PF00743 FMO-like Flavin-binding monooxygenase-like 7.0E-10 3 208
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 9.9E-07 7 52

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LMA1|FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana GN=FMO1 PE=2 SV=1 2 423 1.0E-14
sp|P38866|FMO1_YEAST Thiol-specific monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMO1 PE=1 SV=2 30 219 4.0E-12
sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 2 241 3.0E-11
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 1 222 4.0E-11
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 1 210 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LMA1|FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana GN=FMO1 PE=2 SV=1 2 423 1.0E-14
sp|P38866|FMO1_YEAST Thiol-specific monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMO1 PE=1 SV=2 30 219 4.0E-12
sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 2 241 3.0E-11
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 1 222 4.0E-11
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 1 210 6.0E-11
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 1 222 7.0E-11
sp|P31512|FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens GN=FMO4 PE=1 SV=3 1 212 7.0E-11
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 1 208 9.0E-11
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 1 210 1.0E-10
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 1 210 1.0E-10
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 2 218 2.0E-10
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 1 210 4.0E-10
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 1 208 4.0E-10
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 1 213 4.0E-10
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 1 204 5.0E-10
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 1 210 1.0E-09
sp|P36367|FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus GN=FMO4 PE=2 SV=2 1 212 1.0E-09
sp|Q8K4B7|FMO4_RAT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus GN=Fmo4 PE=2 SV=3 1 211 2.0E-09
sp|O60774|FMO6_HUMAN Putative dimethylaniline monooxygenase [N-oxide-forming] 6 OS=Homo sapiens GN=FMO6P PE=5 SV=1 1 221 5.0E-09
sp|Q8HYJ9|FMO3_BOVIN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Bos taurus GN=FMO3 PE=2 SV=1 1 222 1.0E-08
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 1 222 1.0E-08
sp|Q01740|FMO1_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Homo sapiens GN=FMO1 PE=2 SV=3 1 215 3.0E-08
sp|Q7YS44|FMO3_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Pan troglodytes GN=FMO3 PE=3 SV=3 1 208 6.0E-08
sp|Q9FLK4|GSXL8_ARATH Flavin-containing monooxygenase FMO GS-OX-like 8 OS=Arabidopsis thaliana GN=At5g61290 PE=2 SV=1 2 214 8.0E-08
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 5 217 1.0E-07
sp|P16549|FMO1_PIG Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Sus scrofa GN=FMO1 PE=1 SV=3 1 215 1.0E-07
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 3 208 1.0E-07
sp|Q9FF12|GSXL9_ARATH Flavin-containing monooxygenase FMO GS-OX-like 9 OS=Arabidopsis thaliana GN=At5g07800 PE=2 SV=1 2 204 2.0E-07
sp|P50285|FMO1_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus GN=Fmo1 PE=1 SV=1 1 215 3.0E-07
sp|Q9HFE4|FMO1_SCHPO Thiol-specific monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmo1 PE=1 SV=1 3 218 3.0E-07
sp|P31513|FMO3_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Homo sapiens GN=FMO3 PE=1 SV=5 1 208 3.0E-07
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 4 208 5.0E-07
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 4 208 5.0E-07
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 4 208 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity Yes
GO:0050661 NADP binding Yes
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0048037 cofactor binding No
GO:0050662 coenzyme binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0004497 monooxygenase activity No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1335
MSKSVCVVGAGPSGLVSAKTLLHNAPNGAFRVSLFDQQPAIGGLWPSSRADVERQLHPLMLANQSRHTMHFSDLA
WGADAAQVPRAWEVGRYLDRYLGRYLTGHPAFELRLGTRVVRAEPRADGWDILAEAGGEEEAAHFDYLVLASGHF
GKPLVPTQVLSEPVAVPVIHSCQYRDLKGLLANQAPGGGKILVVGGQMSGVEIAGTIAAHLSSAVNSPGEAGIPD
VDRYSVHHIAQRPIWVFPTFTTPEPEAAAAPFLPLDFSSYNCNNRPLPLTNTQGHVSQDAAKAVHAIFERTLGHD
QSALSPLLHVDDEARINPPYLAVSDWYCDFVRAGLVTLSAGKLASLQGRTATVSPGGAQVHDVAAVVFATGFDPS
PSLSMLPQGTLDKLHHSPRHPTQPLALAFHGTHHPDVPGLGFVGFYRSPYWGVMQMQARLLARLWSDPAPPLLRK
LGADDSVRRTLALRHDPRLSQFPMGDYLWLMQDGCPRCRTTGCRWTC*
Coding >Hirsu2|1335
ATGTCGAAATCGGTCTGCGTCGTCGGCGCCGGCCCGTCTGGCCTCGTCTCGGCCAAGACGCTCCTGCACAATGCG
CCCAACGGAGCCTTCCGGGTCAGCCTGTTCGACCAGCAGCCGGCCATCGGCGGCCTGTGGCCGAGCTCGAGGGCC
GACGTCGAGCGCCAGCTCCATCCGCTGATGCTCGCCAACCAGAGCCGGCACACGATGCACTTCAGCGACCTGGCC
TGGGGCGCCGACGCCGCCCAGGTGCCCCGTGCCTGGGAGGTCGGCCGGTATCTGGACCGCTACCTGGGCCGCTAC
CTGACCGGCCACCCTGCCTTCGAGCTGCGCCTCGGGACCCGCGTCGTCCGGGCCGAGCCGCGGGCCGACGGCTGG
GACATCCTGGCCGAGGCGGGCGGGGAGGAGGAGGCGGCGCACTTCGACTACCTCGTCCTGGCCTCCGGCCACTTC
GGGAAGCCGCTGGTGCCGACGCAGGTCCTCTCGGAGCCCGTCGCCGTCCCCGTCATCCACAGCTGTCAGTATCGG
GACCTGAAAGGGCTGCTGGCCAACCAGGCGCCCGGCGGCGGCAAGATCCTCGTCGTCGGCGGCCAGATGTCCGGC
GTCGAGATCGCCGGCACCATTGCCGCCCACCTCTCCTCGGCCGTCAACTCGCCCGGCGAGGCGGGCATCCCCGAC
GTGGACAGGTACTCGGTCCATCACATCGCTCAACGACCCATATGGGTCTTTCCCACCTTCACCACGCCCGAGCCC
GAGGCTGCAGCCGCGCCCTTTCTCCCCCTCGACTTCTCCTCGTACAACTGCAACAACCGTCCTCTGCCGTTGACC
AACACCCAGGGCCACGTCAGCCAAGACGCGGCCAAGGCGGTCCACGCCATCTTCGAGAGGACCCTCGGCCATGAC
CAGTCTGCCCTGTCGCCGCTGCTGCACGTCGACGACGAGGCCAGGATCAACCCCCCGTATCTGGCCGTCAGCGAC
TGGTACTGCGACTTTGTGCGGGCCGGACTCGTCACCCTGTCCGCCGGCAAGCTCGCCTCGCTGCAGGGAAGGACG
GCGACGGTCTCGCCCGGCGGAGCCCAGGTGCACGACGTGGCGGCCGTCGTCTTCGCCACGGGCTTCGACCCGTCG
CCCAGCCTGAGCATGCTGCCCCAGGGCACGCTCGACAAGCTGCACCACTCGCCGCGGCACCCGACGCAGCCCCTG
GCCCTGGCCTTCCACGGGACGCACCACCCGGACGTGCCCGGGCTCGGCTTCGTCGGCTTCTACCGCTCGCCGTAC
TGGGGCGTCATGCAGATGCAGGCGAGGCTCCTCGCCCGGCTGTGGTCGGATCCCGCGCCGCCGCTGCTGCGCAAG
CTCGGCGCCGACGACTCGGTCCGGCGCACGCTGGCCCTGCGCCACGACCCGCGGCTCTCGCAGTTCCCCATGGGC
GACTACCTCTGGCTGATGCAGGACGGCTGCCCCCGCTGTCGCACAACCGGCTGCCGCTGGACATGCTGA
Transcript >Hirsu2|1335
ATGTCGAAATCGGTCTGCGTCGTCGGCGCCGGCCCGTCTGGCCTCGTCTCGGCCAAGACGCTCCTGCACAATGCG
CCCAACGGAGCCTTCCGGGTCAGCCTGTTCGACCAGCAGCCGGCCATCGGCGGCCTGTGGCCGAGCTCGAGGGCC
GACGTCGAGCGCCAGCTCCATCCGCTGATGCTCGCCAACCAGAGCCGGCACACGATGCACTTCAGCGACCTGGCC
TGGGGCGCCGACGCCGCCCAGGTGCCCCGTGCCTGGGAGGTCGGCCGGTATCTGGACCGCTACCTGGGCCGCTAC
CTGACCGGCCACCCTGCCTTCGAGCTGCGCCTCGGGACCCGCGTCGTCCGGGCCGAGCCGCGGGCCGACGGCTGG
GACATCCTGGCCGAGGCGGGCGGGGAGGAGGAGGCGGCGCACTTCGACTACCTCGTCCTGGCCTCCGGCCACTTC
GGGAAGCCGCTGGTGCCGACGCAGGTCCTCTCGGAGCCCGTCGCCGTCCCCGTCATCCACAGCTGTCAGTATCGG
GACCTGAAAGGGCTGCTGGCCAACCAGGCGCCCGGCGGCGGCAAGATCCTCGTCGTCGGCGGCCAGATGTCCGGC
GTCGAGATCGCCGGCACCATTGCCGCCCACCTCTCCTCGGCCGTCAACTCGCCCGGCGAGGCGGGCATCCCCGAC
GTGGACAGGTACTCGGTCCATCACATCGCTCAACGACCCATATGGGTCTTTCCCACCTTCACCACGCCCGAGCCC
GAGGCTGCAGCCGCGCCCTTTCTCCCCCTCGACTTCTCCTCGTACAACTGCAACAACCGTCCTCTGCCGTTGACC
AACACCCAGGGCCACGTCAGCCAAGACGCGGCCAAGGCGGTCCACGCCATCTTCGAGAGGACCCTCGGCCATGAC
CAGTCTGCCCTGTCGCCGCTGCTGCACGTCGACGACGAGGCCAGGATCAACCCCCCGTATCTGGCCGTCAGCGAC
TGGTACTGCGACTTTGTGCGGGCCGGACTCGTCACCCTGTCCGCCGGCAAGCTCGCCTCGCTGCAGGGAAGGACG
GCGACGGTCTCGCCCGGCGGAGCCCAGGTGCACGACGTGGCGGCCGTCGTCTTCGCCACGGGCTTCGACCCGTCG
CCCAGCCTGAGCATGCTGCCCCAGGGCACGCTCGACAAGCTGCACCACTCGCCGCGGCACCCGACGCAGCCCCTG
GCCCTGGCCTTCCACGGGACGCACCACCCGGACGTGCCCGGGCTCGGCTTCGTCGGCTTCTACCGCTCGCCGTAC
TGGGGCGTCATGCAGATGCAGGCGAGGCTCCTCGCCCGGCTGTGGTCGGATCCCGCGCCGCCGCTGCTGCGCAAG
CTCGGCGCCGACGACTCGGTCCGGCGCACGCTGGCCCTGCGCCACGACCCGCGGCTCTCGCAGTTCCCCATGGGC
GACTACCTCTGGCTGATGCAGGACGGCTGCCCCCGCTGTCGCACAACCGGCTGCCGCTGGACATGCTGA
Gene >Hirsu2|1335
ATGTCGAAATCGGTCTGCGTCGTCGGTGAGTCGCCGGGAAGCCCCGACCGCGCTGCCGAGGTCGCGACGTCCGCA
GATGCGAGGAGCTAGGGGGGGGGGCAGTATCACTTACTCCGGCCGTGCTCCCGCAGGCGCCGGCCCGTCTGGCCT
CGTCTCGGCCAAGACGCTCCTGCACAATGCGCCCAACGGAGCCTTCCGGGTCAGCCTGTTCGACCAGCAGCCGGC
CATCGGCGGCCTGTGGCCGAGCTCGAGGGCCGACGTCGAGCGCCAGCTCCATCCGCTGATGCTCGCCAACCAGAG
CCGGCACACGATGCACTTCAGCGACCTGGCCTGGGGCGCCGACGCCGCCCAGGTGCCCCGTGCCTGGGAGGTCGG
CCGGTATCTGGACCGCTACCTGGGCCGCTACCTGACCGGCCACCCTGCCTTCGAGCTGCGCCTCGGGACCCGCGT
CGTCCGGGCCGAGCCGCGGGCCGACGGCTGGGACATCCTGGCCGAGGCGGGCGGGGAGGAGGAGGCGGCGCACTT
CGACTACCTCGTCCTGGCCTCCGGCCACTTCGGGAAGCCGCTGGTGCCGACGCAGGTCCTCTCGGAGCCCGTCGC
CGTCCCCGTCATCCACAGCTGTCAGTATCGGGACCTGAAAGGGCTGCTGGCCAACCAGGCGCCCGGCGGCGGCAA
GATCCTCGTCGTCGGCGGCCAGATGTCCGGCGTCGAGATCGCCGGCACCATTGCCGCCCACCTCTCCTCGGCCGT
CAACTCGCCCGGCGAGGCGGGCATCCCCGACGTGGACAGGTACTCGGTCCATCACATCGCTCAACGACCCATATG
GGTCTTTCCCACCTTCACCACGCCCGAGGTGAGTGCCGTGGAATCTGTGTCGAGGCCATACATATACCCCCGGCT
GATCCGATCGAGCAGCCCGAGGCTGCAGCCGCGCCCTTTCTCCCCCTCGACTTCTCCTCGTACAACTGCAACAAC
CGTCCTCTGCCGTTGACCAACACCCAGGGCCACGTCAGCCAAGACGCGGCCAAGGCGGTCCACGCCATCTTCGAG
AGGACCCTCGGCCATGACCAGTCTGCCCTGTCGCCGCTGCTGCACGTCGACGACGAGGCCAGGATCAACCCCCCG
TATCTGGCCGTCAGCGACTGGTACTGCGACTTTGTGCGGGCCGGACTCGTCACCCTGTCCGCCGGCAAGCTCGCC
TCGCTGCAGGGAAGGACGGCGACGGTCTCGCCCGGCGGAGCCCAGGTGCACGACGTGGCGGCCGTCGTCTTCGCC
ACGGGCTTCGACCCGTCGCCCAGCCTGAGCATGCTGCCCCAGGGCACGCTCGACAAGCTGCACCACTCGCCGCGG
CACCCGACGCAGCCCCTGGCCCTGGCCTTCCACGGGACGCACCACCCGGACGTGCCCGGGCTCGGCTTCGTCGGC
TTCTACCGCTCGCCGTACTGGGGCGTCATGCAGATGCAGGCGAGGCTCCTCGCCCGGCTGTGGTCGGATCCCGCG
CCGCCGCTGCTGCGCAAGCTCGGCGCCGACGACTCGGTCCGGCGCACGCTGGCCCTGCGCCACGACCCGCGGCTC
TCGCAGTTCCCCATGGGCGACTACCTCTGGCTGATGCAGGAGTTCGCCGAGGCCCTCTCGATCGAGCGCACGGGC
GCGCCGCCGGAGCGGCTGCCCCCGCTGTCGCACAACCGGCTGCCGCTGGACATGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail