Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1332
Gene name
LocationContig_1292:1910..2882
Strand+
Gene length (bp)972
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13460 NAD_binding_10 NAD(P)H-binding 2.7E-22 14 227
PF01370 Epimerase NAD dependent epimerase/dehydratase family 2.5E-05 10 254

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7K0|YGL3_SCHPO UPF0659 protein C216.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC216.03 PE=3 SV=1 11 266 2.0E-11
sp|O07609|YHFK_BACSU Uncharacterized sugar epimerase YhfK OS=Bacillus subtilis (strain 168) GN=yhfK PE=2 SV=1 10 251 8.0E-09

GO

GO Term Description Terminal node
GO:0050662 coenzyme binding Yes
GO:0003824 catalytic activity Yes
GO:0048037 cofactor binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1332
MASASKQHHVLVLGGHGKIAQLLTPLLLRRSWTVTSLIRARDQIPAIEKLGAGLPGKLNVLVRSIDDVDSQEHAA
GILDEVRPDYVAWSAGAGGSGGPERTFKIDRDAAAHFIRASAARPSISRFLLVSYTGSRRAGASWWPAGEWDDYD
RSVNNGALATYHKAKIAADEVLYETSKKSASLVGICLRPGTLTLEPAGKVELGRTAHVKGNVSRASVAETAAALL
AADGVKNCWLDLLDGKEDVASAVHRVVADGTDAAEGESVYTS*
Coding >Hirsu2|1332
ATGGCCTCCGCCTCCAAGCAGCACCACGTCCTCGTCCTCGGCGGCCACGGCAAGATCGCCCAGCTGCTGACGCCG
CTGCTGCTGCGCCGCTCCTGGACCGTCACCAGCCTCATCCGCGCCCGCGACCAGATCCCCGCCATCGAGAAGCTC
GGCGCCGGCCTGCCCGGCAAGCTCAACGTCCTGGTCCGCAGCATCGACGACGTCGACAGCCAGGAGCACGCGGCG
GGCATCCTGGACGAGGTGAGGCCCGACTATGTCGCCTGGAGCGCCGGCGCCGGAGGCAGTGGTGGTCCGGAAAGG
ACCTTCAAGATCGACCGCGACGCCGCCGCCCACTTCATTCGCGCCTCCGCCGCAAGGCCCTCCATCAGCCGCTTC
CTCCTCGTCTCCTACACGGGCTCGCGCCGCGCGGGGGCGTCGTGGTGGCCCGCCGGCGAGTGGGACGACTACGAC
AGGTCGGTCAACAACGGCGCGCTGGCGACCTACCACAAGGCCAAGATCGCCGCCGACGAGGTCCTGTACGAGACG
TCCAAGAAGAGCGCCTCCCTCGTCGGCATCTGCCTGCGCCCCGGCACCCTGACGCTCGAGCCGGCGGGCAAGGTC
GAGCTGGGCAGGACGGCGCACGTCAAGGGCAACGTGAGCAGGGCCTCGGTGGCCGAGACCGCGGCCGCGCTGCTG
GCGGCCGACGGCGTCAAGAACTGCTGGCTGGACCTGTTGGACGGCAAGGAAGACGTGGCGTCGGCCGTCCACAGA
GTTGTGGCGGACGGCACCGACGCGGCGGAGGGAGAATCCGTCTATACCTCGTAG
Transcript >Hirsu2|1332
ATGGCCTCCGCCTCCAAGCAGCACCACGTCCTCGTCCTCGGCGGCCACGGCAAGATCGCCCAGCTGCTGACGCCG
CTGCTGCTGCGCCGCTCCTGGACCGTCACCAGCCTCATCCGCGCCCGCGACCAGATCCCCGCCATCGAGAAGCTC
GGCGCCGGCCTGCCCGGCAAGCTCAACGTCCTGGTCCGCAGCATCGACGACGTCGACAGCCAGGAGCACGCGGCG
GGCATCCTGGACGAGGTGAGGCCCGACTATGTCGCCTGGAGCGCCGGCGCCGGAGGCAGTGGTGGTCCGGAAAGG
ACCTTCAAGATCGACCGCGACGCCGCCGCCCACTTCATTCGCGCCTCCGCCGCAAGGCCCTCCATCAGCCGCTTC
CTCCTCGTCTCCTACACGGGCTCGCGCCGCGCGGGGGCGTCGTGGTGGCCCGCCGGCGAGTGGGACGACTACGAC
AGGTCGGTCAACAACGGCGCGCTGGCGACCTACCACAAGGCCAAGATCGCCGCCGACGAGGTCCTGTACGAGACG
TCCAAGAAGAGCGCCTCCCTCGTCGGCATCTGCCTGCGCCCCGGCACCCTGACGCTCGAGCCGGCGGGCAAGGTC
GAGCTGGGCAGGACGGCGCACGTCAAGGGCAACGTGAGCAGGGCCTCGGTGGCCGAGACCGCGGCCGCGCTGCTG
GCGGCCGACGGCGTCAAGAACTGCTGGCTGGACCTGTTGGACGGCAAGGAAGACGTGGCGTCGGCCGTCCACAGA
GTTGTGGCGGACGGCACCGACGCGGCGGAGGGAGAATCCGTCTATACCTCGTAG
Gene >Hirsu2|1332
ATGGCCTCCGCCTCCAAGCAGCACCACGTCCTCGTCCTCGGCGGCCACGGCAAGATCGCCCAGCTGCTGACGCCG
CTGCTGCTGCGCCGCTCCTGGACCGTCACCAGCCTCATCCGCGCCCGCGACCAGATCCCCGCCATCGAGAAGCTC
GGCGCCGGCCTGCCCGGCAAGCTCAACGTCCTGGTCCGCAGCATCGACGACGTCGACAGCCAGGAGCACGCGGCG
GGCATCCTGGACGAGGTGAGGCCCGACTATGTCGCCTGGAGCGCCGGTGAGCTTTCTCGTCCCCGGGAGCGGAGC
GGAGGACGGAGGCCGGGCTGGCTGACTGGCTTGGTTGACTTGATGACGCAGGCGCCGGAGGCAGTGGTGGTCCGG
AAAGGGTACGAAAGCGACCTCTTCCCCTTCTTCTCTGCCCCGTGCGGACAGTGGCTAACGAGGGCCGCAAACTCG
GGGACGGCGGACGTCCAGACCTTCAAGATCGACCGCGACGCCGCCGCCCACTTCATTCGCGCCTCCGCCGCAAGG
CCCTCCATCAGCCGCTTCCTCCTCGTCTCCTACACGGGCTCGCGCCGCGCGGGGGCGTCGTGGTGGCCCGCCGGC
GAGTGGGACGACTACGACAGGTCGGTCAACAACGGCGCGCTGGCGACCTACCACAAGGCCAAGATCGCCGCCGAC
GAGGTCCTGTACGAGACGTCCAAGAAGAGCGCCTCCCTCGTCGGCATCTGCCTGCGCCCCGGCACCCTGACGCTC
GAGCCGGCGGGCAAGGTCGAGCTGGGCAGGACGGCGCACGTCAAGGGCAACGTGAGCAGGGCCTCGGTGGCCGAG
ACCGCGGCCGCGCTGCTGGCGGCCGACGGCGTCAAGAACTGCTGGCTGGACCTGTTGGACGGCAAGGAAGACGTG
GCGTCGGCCGTCCACAGAGTTGTGGCGGACGGCACCGACGCGGCGGAGGGAGAATCCGTCTATACCTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail