Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1326
Gene name
LocationContig_129:33184..34480
Strand+
Gene length (bp)1296
Transcript length (bp)1137
Coding sequence length (bp)1137
Protein length (aa) 379

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13912 zf-C2H2_6 C2H2-type zinc finger 1.1E-02 174 194
PF00096 zf-C2H2 Zinc finger, C2H2 type 9.6E-06 168 193

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTM0|IEC1_SCHPO INO80 complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iec1 PE=1 SV=1 74 219 5.0E-46
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 6 191 5.0E-18
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 2 191 3.0E-17
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 66 191 2.0E-16
sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 101 191 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTM0|IEC1_SCHPO INO80 complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iec1 PE=1 SV=1 74 219 5.0E-46
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 6 191 5.0E-18
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 2 191 3.0E-17
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 66 191 2.0E-16
sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 101 191 2.0E-16
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 101 191 3.0E-16
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 101 191 4.0E-16
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 66 191 4.0E-16
sp|Q91660|GLI3_XENLA Zinc finger protein GLI3 OS=Xenopus laevis GN=gli3 PE=2 SV=1 101 191 7.0E-16
sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 101 191 8.0E-16
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 101 191 8.0E-16
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 57 191 1.0E-15
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 91 191 4.0E-15
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 72 191 6.0E-15
sp|P19538|CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster GN=ci PE=1 SV=2 82 191 1.0E-13
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 113 191 4.0E-12
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 113 191 5.0E-12
sp|Q8SV95|Z6B5_ENCCU Zinc finger C2H2 protein ECU06_1150 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_1150 PE=3 SV=1 103 189 1.0E-11
sp|Q61467|ZIC4_MOUSE Zinc finger protein ZIC 4 OS=Mus musculus GN=Zic4 PE=1 SV=2 55 191 2.0E-11
sp|Q8N9L1|ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens GN=ZIC4 PE=2 SV=3 99 191 4.0E-11
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 99 191 5.0E-11
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 113 191 5.0E-11
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 113 191 6.0E-11
sp|Q8NEA6|GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens GN=GLIS3 PE=2 SV=5 89 191 7.0E-11
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 113 191 7.0E-11
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 113 191 8.0E-11
sp|Q8K1M4|GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus GN=Glis1 PE=2 SV=2 102 191 9.0E-11
sp|Q98T94|GLIS2_XENLA Zinc finger protein GLIS2 OS=Xenopus laevis GN=glis2 PE=2 SV=1 84 191 9.0E-11
sp|Q8NBF1|GLIS1_HUMAN Zinc finger protein GLIS1 OS=Homo sapiens GN=GLIS1 PE=2 SV=2 102 191 1.0E-10
sp|Q9IB89|ZIC5_XENLA Zinc finger protein ZIC 5 OS=Xenopus laevis GN=zic5 PE=2 SV=1 113 191 1.0E-10
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 113 191 1.0E-10
sp|Q6XP49|GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus GN=Glis3 PE=1 SV=2 103 191 1.0E-10
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 113 191 2.0E-10
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 113 191 2.0E-10
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 113 191 2.0E-10
sp|Q17308|TRA1_CAEBR Sex-determining transformer protein 1 OS=Caenorhabditis briggsae GN=tra-1 PE=1 SV=1 102 191 2.0E-10
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 103 191 3.0E-10
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 91 191 4.0E-10
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 102 191 4.0E-10
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 113 191 5.0E-10
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 86 191 5.0E-10
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 103 191 5.0E-10
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 103 191 5.0E-10
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 43 191 5.0E-10
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 103 191 5.0E-10
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 88 191 7.0E-10
sp|A4FV57|AEBP2_BOVIN Zinc finger protein AEBP2 OS=Bos taurus GN=AEBP2 PE=2 SV=2 103 191 1.0E-09
sp|Q7SXV2|AEBP2_DANRE Zinc finger protein AEBP2 OS=Danio rerio GN=aebp2 PE=2 SV=2 103 191 2.0E-09
sp|Q9Z248|AEBP2_MOUSE Zinc finger protein AEBP2 OS=Mus musculus GN=Aebp2 PE=1 SV=2 103 191 2.0E-09
sp|Q6ZN18|AEBP2_HUMAN Zinc finger protein AEBP2 OS=Homo sapiens GN=AEBP2 PE=1 SV=2 103 191 2.0E-09
sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 91 191 4.0E-09
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 85 191 4.0E-09
sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens GN=GLIS2 PE=1 SV=2 102 191 5.0E-09
sp|Q753Y2|PACC_ASHGO pH-response transcription factor pacC/RIM101 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RIM101 PE=3 SV=1 82 199 5.0E-09
sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 113 191 5.0E-09
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 128 191 5.0E-09
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 85 191 6.0E-09
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 115 191 7.0E-09
sp|Q6GR30|AEBP2_XENLA Zinc finger protein aebp2 OS=Xenopus laevis GN=aebp2 PE=2 SV=1 103 191 8.0E-09
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 98 191 9.0E-09
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 102 211 1.0E-08
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 128 191 1.0E-08
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 85 191 2.0E-08
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 53 191 2.0E-08
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 130 191 2.0E-08
sp|Q7K0S9|GLIS2_DROME Zinc finger protein GLIS2 homolog OS=Drosophila melanogaster GN=sug PE=2 SV=1 102 191 2.0E-08
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 130 191 3.0E-08
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 53 191 3.0E-08
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 44 191 3.0E-08
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 102 210 4.0E-08
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 102 210 5.0E-08
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 102 190 6.0E-08
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 99 188 7.0E-08
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 85 190 7.0E-08
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 85 190 7.0E-08
sp|Q9Z0Z7|KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus GN=Klf5 PE=2 SV=2 79 190 8.0E-08
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 97 188 9.0E-08
sp|O74252|STE12_EMENI Transcription factor steA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=steA PE=2 SV=1 132 196 1.0E-07
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 87 190 2.0E-07
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 102 265 3.0E-07
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 102 265 3.0E-07
sp|Q98T94|GLIS2_XENLA Zinc finger protein GLIS2 OS=Xenopus laevis GN=glis2 PE=2 SV=1 97 258 3.0E-07
sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 102 196 3.0E-07
sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 102 196 3.0E-07
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 78 188 3.0E-07
sp|Q5A4K7|TRY5_CANAL Transcriptional regulator of yeast form adherence 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY5 PE=3 SV=1 132 214 3.0E-07
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 53 191 3.0E-07
sp|P53035|MIG2_YEAST Regulatory protein MIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG2 PE=1 SV=1 125 191 3.0E-07
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 102 196 4.0E-07
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 102 196 4.0E-07
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 131 232 4.0E-07
sp|O35819|KLF6_RAT Krueppel-like factor 6 OS=Rattus norvegicus GN=Klf6 PE=2 SV=2 43 190 4.0E-07
sp|O08584|KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus GN=Klf6 PE=2 SV=3 43 190 4.0E-07
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 131 232 4.0E-07
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 131 232 4.0E-07
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 102 190 5.0E-07
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 102 199 5.0E-07
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 102 199 5.0E-07
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 102 196 8.0E-07
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 130 191 8.0E-07
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 102 190 8.0E-07
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 88 190 8.0E-07
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 133 191 8.0E-07
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 100 191 8.0E-07
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 131 191 8.0E-07
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 130 191 9.0E-07
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 131 191 9.0E-07
sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 PE=1 SV=2 102 190 9.0E-07
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 102 190 9.0E-07
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 132 191 9.0E-07
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 132 191 9.0E-07
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 100 191 9.0E-07
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 132 191 9.0E-07
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 75 188 1.0E-06
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 78 188 1.0E-06
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 75 188 1.0E-06
sp|P47043|ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZAP1 PE=1 SV=1 97 225 1.0E-06
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 133 191 1.0E-06
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 133 191 1.0E-06
sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 132 190 1.0E-06
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 132 191 1.0E-06
sp|P10069|BRLA_EMENI Regulatory protein brlA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=brlA PE=3 SV=1 131 199 1.0E-06
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 133 191 1.0E-06
sp|O77027|CI_DROYA Protein cubitus interruptus (Fragment) OS=Drosophila yakuba GN=ci PE=3 SV=1 132 196 1.0E-06
sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=KLF8 PE=1 SV=2 103 190 1.0E-06
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 108 196 1.0E-06
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 102 196 2.0E-06
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 102 196 2.0E-06
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 102 196 2.0E-06
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 102 196 2.0E-06
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 75 188 2.0E-06
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 78 188 2.0E-06
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 130 191 2.0E-06
sp|Q9ESX2|SP6_MOUSE Transcription factor Sp6 OS=Mus musculus GN=Sp6 PE=2 SV=2 77 191 2.0E-06
sp|Q9ET58|KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus GN=Klf2 PE=1 SV=1 132 190 2.0E-06
sp|Q8BLM0|KLF8_MOUSE Krueppel-like factor 8 OS=Mus musculus GN=Klf8 PE=2 SV=1 103 190 2.0E-06
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 75 188 3.0E-06
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 103 190 3.0E-06
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 103 190 3.0E-06
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 130 191 3.0E-06
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 103 190 4.0E-06
sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens GN=KLF15 PE=1 SV=1 133 191 4.0E-06
sp|Q9P7D9|RSV1_SCHPO Zinc finger protein rsv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsv1 PE=2 SV=1 133 198 4.0E-06
sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 130 190 4.0E-06
sp|Q7KHG2|JING_DROME Zinc finger protein jing OS=Drosophila melanogaster GN=jing PE=2 SV=1 102 209 4.0E-06
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 133 191 4.0E-06
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 75 188 5.0E-06
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 97 190 5.0E-06
sp|Q3SY56|SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens GN=SP6 PE=2 SV=1 107 191 5.0E-06
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 103 190 6.0E-06
sp|Q9Y4X4|KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens GN=KLF12 PE=1 SV=2 97 190 6.0E-06
sp|O35738|KLF12_MOUSE Krueppel-like factor 12 OS=Mus musculus GN=Klf12 PE=1 SV=2 97 190 6.0E-06
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 130 191 7.0E-06
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 119 191 7.0E-06
sp|Q17PR1|JING_AEDAE Zinc finger protein jing homolog OS=Aedes aegypti GN=AAEL000263 PE=3 SV=1 8 220 7.0E-06
sp|Q99612|KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens GN=KLF6 PE=1 SV=3 95 190 7.0E-06
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 102 188 8.0E-06
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 102 196 8.0E-06
sp|Q9BXK1|KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens GN=KLF16 PE=1 SV=1 108 190 8.0E-06
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 126 191 8.0E-06
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 131 191 9.0E-06
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 131 191 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1326
MPRHQYSPPDSPLSSMGSEEAYDDDGHDDDDEASLRPSKRQKVEAGSTASSAVVPDAEPETVPEPDPLEGMSDVS
SDTSGDIPSSPVNARLDEEDFQDQVTVCDWDGCPAGDLGNMDRLVEHIHNSHIENRQKKYTCEWKSCNRKGLPHA
SGYALKAHMRSHTREKPFYCYLPECDRSFTRSDALAKHMRTVHETEALRPSDPVPKSMQSGPTGKSSKLKIIIKT
PQSHGGGQDDSADASVNGEDVSSDFFTALTAELFSSEELAFPVDKLYRKCYWESKWADEVGDALKKECKEWEDVY
YKEWLEKEVLLSQVIKSEVDWHERRQAILSGTADVQVTGVVEAQEERQANGVGEERQPEDEAEPTPAATSAAAQA
VEA*
Coding >Hirsu2|1326
ATGCCGCGCCACCAGTACTCGCCTCCCGACTCTCCGCTGTCGTCGATGGGGTCGGAGGAGGCCTACGACGACGAC
GGGCACGACGACGACGACGAGGCCTCGCTGCGCCCCTCGAAGCGGCAAAAGGTCGAGGCCGGGTCGACGGCGTCG
TCGGCCGTCGTCCCCGACGCCGAGCCCGAGACGGTGCCCGAGCCGGATCCGCTCGAGGGCATGTCGGACGTCTCG
TCGGACACGTCGGGCGACATCCCGAGCTCGCCCGTCAACGCCCGGCTGGACGAGGAGGACTTCCAGGACCAGGTC
ACCGTCTGCGACTGGGACGGCTGCCCGGCCGGCGACCTCGGCAACATGGACCGCCTGGTCGAGCACATCCACAAC
TCGCACATCGAGAACCGGCAAAAGAAGTACACGTGCGAGTGGAAGAGCTGCAACCGCAAGGGCCTCCCCCACGCC
AGCGGCTATGCCCTCAAGGCGCACATGCGCAGCCACACGAGGGAGAAGCCCTTTTACTGCTACCTGCCTGAATGC
GATCGCTCATTTACTAGATCGGATGCCCTCGCCAAGCACATGCGGACAGTCCACGAAACCGAGGCCCTCCGGCCC
TCCGACCCCGTACCCAAGTCGATGCAGTCGGGCCCGACGGGCAAGTCGAGCAAGCTGAAAATCATCATCAAGACG
CCGCAGTCGCACGGCGGCGGCCAGGACGACAGCGCCGACGCGTCGGTCAACGGCGAGGACGTCAGCTCCGACTTC
TTCACCGCCCTCACCGCCGAGCTTTTCTCGTCGGAAGAGCTGGCCTTCCCGGTCGACAAGCTGTACCGCAAGTGC
TACTGGGAGTCCAAGTGGGCTGACGAGGTCGGCGACGCGCTCAAGAAGGAGTGCAAGGAGTGGGAGGACGTCTAC
TACAAGGAGTGGCTGGAGAAGGAGGTGCTGCTGTCCCAGGTCATCAAGAGCGAGGTCGACTGGCACGAGAGGCGG
CAGGCCATCCTGTCCGGGACCGCCGACGTGCAGGTGACGGGCGTCGTCGAGGCCCAGGAGGAGCGCCAGGCCAAC
GGGGTCGGCGAGGAGCGCCAGCCCGAAGACGAGGCCGAGCCCACGCCCGCCGCCACGAGCGCGGCGGCCCAGGCC
GTCGAAGCCTGA
Transcript >Hirsu2|1326
ATGCCGCGCCACCAGTACTCGCCTCCCGACTCTCCGCTGTCGTCGATGGGGTCGGAGGAGGCCTACGACGACGAC
GGGCACGACGACGACGACGAGGCCTCGCTGCGCCCCTCGAAGCGGCAAAAGGTCGAGGCCGGGTCGACGGCGTCG
TCGGCCGTCGTCCCCGACGCCGAGCCCGAGACGGTGCCCGAGCCGGATCCGCTCGAGGGCATGTCGGACGTCTCG
TCGGACACGTCGGGCGACATCCCGAGCTCGCCCGTCAACGCCCGGCTGGACGAGGAGGACTTCCAGGACCAGGTC
ACCGTCTGCGACTGGGACGGCTGCCCGGCCGGCGACCTCGGCAACATGGACCGCCTGGTCGAGCACATCCACAAC
TCGCACATCGAGAACCGGCAAAAGAAGTACACGTGCGAGTGGAAGAGCTGCAACCGCAAGGGCCTCCCCCACGCC
AGCGGCTATGCCCTCAAGGCGCACATGCGCAGCCACACGAGGGAGAAGCCCTTTTACTGCTACCTGCCTGAATGC
GATCGCTCATTTACTAGATCGGATGCCCTCGCCAAGCACATGCGGACAGTCCACGAAACCGAGGCCCTCCGGCCC
TCCGACCCCGTACCCAAGTCGATGCAGTCGGGCCCGACGGGCAAGTCGAGCAAGCTGAAAATCATCATCAAGACG
CCGCAGTCGCACGGCGGCGGCCAGGACGACAGCGCCGACGCGTCGGTCAACGGCGAGGACGTCAGCTCCGACTTC
TTCACCGCCCTCACCGCCGAGCTTTTCTCGTCGGAAGAGCTGGCCTTCCCGGTCGACAAGCTGTACCGCAAGTGC
TACTGGGAGTCCAAGTGGGCTGACGAGGTCGGCGACGCGCTCAAGAAGGAGTGCAAGGAGTGGGAGGACGTCTAC
TACAAGGAGTGGCTGGAGAAGGAGGTGCTGCTGTCCCAGGTCATCAAGAGCGAGGTCGACTGGCACGAGAGGCGG
CAGGCCATCCTGTCCGGGACCGCCGACGTGCAGGTGACGGGCGTCGTCGAGGCCCAGGAGGAGCGCCAGGCCAAC
GGGGTCGGCGAGGAGCGCCAGCCCGAAGACGAGGCCGAGCCCACGCCCGCCGCCACGAGCGCGGCGGCCCAGGCC
GTCGAAGCCTGA
Gene >Hirsu2|1326
ATGCCGCGCCACCAGTACTCGCCTCCCGACTCTCCGCTGTCGTCGATGGGGTCGGAGGAGGCCTACGACGACGAC
GGGCACGACGACGACGACGAGGCCTCGCTGCGCCCCTCGAAGCGGCAAAAGGTCGAGGCCGGGTCGACGGCGTCG
TCGGCCGTCGTCCCCGACGCCGAGCCCGAGACGGTGCCCGAGCCGGATCCGCTCGAGGGCATGTCGGACGTCTCG
TCGGACACGTCGGGCGACATCCCGAGCTCGCCCGTCAACGCCCGGCTGGACGAGGAGGACTTCCAGGACCAGGTC
ACCGTCTGCGACTGGGACGGCTGCCCGGCCGGCGACCTCGGCAACATGGACCGCCTGGTCGAGCACATCCACAAC
TCGCACATCGAGAACCGGCAAAAGAAGTACACGTGCGAGTGGAAGAGCTGCAACCGCAAGGGCCTCCCCCACGCC
AGCGGCTATGCCCTCAAGGCGCACATGCGCAGCCACACGAGGGAGAAGCCCTTTTACTGCTACCTGCCTGGTACG
ACGACCGCAGCCCGTGCCGCCGCACGCACGCACGCACGCACGCACACATACTCTCTCTTTCCATTTCTCCCCCGC
TTTCCCTCTCCTTCTCGCTCTCTCTCTCTGCCTCTCTCTCTCTTGTGCAGTCGCGGCTAATCACCAGGCTCCCGC
ACAGAATGCGATCGCTCATTTACTAGATCGGATGCCCTCGCCAAGCACATGCGGACAGTCCACGAAACCGAGGCC
CTCCGGCCCTCCGACCCCGTACCCAAGTCGATGCAGTCGGGCCCGACGGGCAAGTCGAGCAAGCTGAAAATCATC
ATCAAGACGCCGCAGTCGCACGGCGGCGGCCAGGACGACAGCGCCGACGCGTCGGTCAACGGCGAGGACGTCAGC
TCCGACTTCTTCACCGCCCTCACCGCCGAGCTTTTCTCGTCGGAAGAGCTGGCCTTCCCGGTCGACAAGCTGTAC
CGCAAGTGCTACTGGGAGTCCAAGTGGGCTGACGAGGTCGGCGACGCGCTCAAGAAGGAGTGCAAGGAGTGGGAG
GACGTCTACTACAAGGAGTGGCTGGAGAAGGAGGTGCTGCTGTCCCAGGTCATCAAGAGCGAGGTCGACTGGCAC
GAGAGGCGGCAGGCCATCCTGTCCGGGACCGCCGACGTGCAGGTGACGGGCGTCGTCGAGGCCCAGGAGGAGCGC
CAGGCCAACGGGGTCGGCGAGGAGCGCCAGCCCGAAGACGAGGCCGAGCCCACGCCCGCCGCCACGAGCGCGGCG
GCCCAGGCCGTCGAAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail