Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1322
Gene name
LocationContig_129:23490..24927
Strand+
Gene length (bp)1437
Transcript length (bp)1347
Coding sequence length (bp)1347
Protein length (aa) 449

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01070 FMN_dh FMN-dependent dehydrogenase 2.2E-122 80 436
PF03060 NMO Nitronate monooxygenase 1.2E-07 299 389
PF01645 Glu_synthase Conserved region in glutamate synthase 7.8E-05 358 395

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDX2|YKN3_SCHPO Uncharacterized lactate 2-monooxygenase PB1A11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A11.03 PE=3 SV=1 42 439 5.0E-116
sp|Q9UJM8|HAOX1_HUMAN Hydroxyacid oxidase 1 OS=Homo sapiens GN=HAO1 PE=1 SV=1 74 437 2.0E-85
sp|P21795|LA2M_MYCSM Lactate 2-monooxygenase OS=Mycobacterium smegmatis PE=1 SV=3 49 436 7.0E-85
sp|Q9WU19|HAOX1_MOUSE Hydroxyacid oxidase 1 OS=Mus musculus GN=Hao1 PE=1 SV=1 77 437 5.0E-83
sp|Q9NYQ3|HAOX2_HUMAN Hydroxyacid oxidase 2 OS=Homo sapiens GN=HAO2 PE=1 SV=1 76 436 1.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDX2|YKN3_SCHPO Uncharacterized lactate 2-monooxygenase PB1A11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A11.03 PE=3 SV=1 42 439 5.0E-116
sp|Q9UJM8|HAOX1_HUMAN Hydroxyacid oxidase 1 OS=Homo sapiens GN=HAO1 PE=1 SV=1 74 437 2.0E-85
sp|P21795|LA2M_MYCSM Lactate 2-monooxygenase OS=Mycobacterium smegmatis PE=1 SV=3 49 436 7.0E-85
sp|Q9WU19|HAOX1_MOUSE Hydroxyacid oxidase 1 OS=Mus musculus GN=Hao1 PE=1 SV=1 77 437 5.0E-83
sp|Q9NYQ3|HAOX2_HUMAN Hydroxyacid oxidase 2 OS=Homo sapiens GN=HAO2 PE=1 SV=1 76 436 1.0E-73
sp|Q8H3I4|GLO4_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Oryza sativa subsp. japonica GN=GLO4 PE=2 SV=2 80 433 2.0E-72
sp|Q07523|HAOX2_RAT Hydroxyacid oxidase 2 OS=Rattus norvegicus GN=Hao2 PE=1 SV=2 76 436 5.0E-72
sp|B8B8K5|GLO4_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Oryza sativa subsp. indica GN=GLO4 PE=3 SV=2 80 433 2.0E-69
sp|Q9NYQ2|HAOX2_MOUSE Hydroxyacid oxidase 2 OS=Mus musculus GN=Hao2 PE=1 SV=1 76 436 3.0E-69
sp|O52792|HMO_AMYOR 4-hydroxymandelate oxidase OS=Amycolatopsis orientalis GN=hmo PE=1 SV=1 76 432 1.0E-68
sp|P05414|GOX_SPIOL Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia oleracea PE=1 SV=1 71 433 2.0E-68
sp|Q3ZBW2|HAOX2_BOVIN Hydroxyacid oxidase 2 OS=Bos taurus GN=HAO2 PE=2 SV=1 76 436 6.0E-68
sp|Q54E41|HAOX_DICDI Hydroxyacid oxidase OS=Dictyostelium discoideum GN=haox PE=3 SV=1 75 435 2.0E-67
sp|O49506|GLO5_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Arabidopsis thaliana GN=GLO5 PE=1 SV=1 71 436 2.0E-65
sp|Q6YT73|GLO5_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. japonica GN=GLO5 PE=2 SV=1 71 433 5.0E-65
sp|B8B7C5|GLO5_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. indica GN=GLO5 PE=3 SV=1 71 433 5.0E-65
sp|Q9LJH5|GLO4_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Arabidopsis thaliana GN=GLO4 PE=2 SV=1 74 436 7.0E-65
sp|Q9LRS0|GLO2_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Arabidopsis thaliana GN=GLO2 PE=1 SV=1 71 433 1.0E-64
sp|Q24JJ8|GLO3_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Arabidopsis thaliana GN=GLO3 PE=2 SV=1 74 436 2.0E-64
sp|Q10CE4|GLO1_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. japonica GN=GLO1 PE=1 SV=1 71 433 2.0E-63
sp|B8AKX6|GLO1_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. indica GN=GLO1 PE=3 SV=1 71 433 2.0E-63
sp|Q9LRR9|GLO1_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Arabidopsis thaliana GN=GLO1 PE=1 SV=1 71 433 4.0E-63
sp|C3K053|LLDD_PSEFS L-lactate dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=lldD PE=3 SV=2 68 435 1.0E-61
sp|Q4ZY06|LLDD_PSEU2 L-lactate dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lldD PE=3 SV=1 68 435 2.0E-61
sp|Q7FAS1|GLO3_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Oryza sativa subsp. japonica GN=GLO3 PE=2 SV=1 69 433 6.0E-61
sp|B8AUI3|GLO3_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Oryza sativa subsp. indica GN=GLO3 PE=3 SV=1 69 433 6.0E-61
sp|Q6DAY3|LLDD_PECAS L-lactate dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lldD PE=3 SV=1 68 438 1.0E-60
sp|B4SMK1|LLDD_STRM5 L-lactate dehydrogenase OS=Stenotrophomonas maltophilia (strain R551-3) GN=lldD PE=3 SV=1 68 435 1.0E-58
sp|B1JPU0|LLDD_YERPY L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lldD PE=3 SV=1 68 435 1.0E-58
sp|Q66C32|LLDD_YERPS L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lldD PE=3 SV=1 68 435 1.0E-58
sp|A4TKI4|LLDD_YERPP L-lactate dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=lldD PE=3 SV=1 68 435 1.0E-58
sp|Q1CGZ1|LLDD_YERPN L-lactate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lldD PE=3 SV=1 68 435 1.0E-58
sp|A9R623|LLDD_YERPG L-lactate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lldD PE=3 SV=1 68 435 1.0E-58
sp|Q8ZFV8|LLDD_YERPE L-lactate dehydrogenase OS=Yersinia pestis GN=lldD PE=3 SV=1 68 435 1.0E-58
sp|B2JZQ1|LLDD_YERPB L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lldD PE=3 SV=1 68 435 1.0E-58
sp|Q1C9P0|LLDD_YERPA L-lactate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lldD PE=3 SV=1 68 435 1.0E-58
sp|A7FJF0|LLDD_YERP3 L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lldD PE=3 SV=1 68 435 1.0E-58
sp|Q87G18|LLDD_VIBPA L-lactate dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lldD PE=3 SV=1 78 438 2.0E-58
sp|B7LTL2|LLDD_ESCF3 L-lactate dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=lldD PE=3 SV=1 68 438 3.0E-58
sp|A7MNF6|LLDD_CROS8 L-lactate dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lldD PE=3 SV=1 68 435 3.0E-58
sp|B0BTC7|LLDD_ACTPJ L-lactate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=lldD PE=3 SV=1 68 435 3.0E-58
sp|B3GZA5|LLDD_ACTP7 L-lactate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=lldD PE=3 SV=1 68 435 4.0E-58
sp|A3N3E5|LLDD_ACTP2 L-lactate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=lldD PE=3 SV=1 68 435 4.0E-58
sp|B1LK44|LLDD_ECOSM L-lactate dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=lldD PE=3 SV=1 68 438 5.0E-58
sp|B2U5C2|LLDD_SHIB3 L-lactate dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=lldD PE=3 SV=1 68 436 5.0E-58
sp|B7NER0|LLDD_ECOLU L-lactate dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=lldD PE=3 SV=1 68 436 5.0E-58
sp|P33232|LLDD_ECOLI L-lactate dehydrogenase OS=Escherichia coli (strain K12) GN=lldD PE=1 SV=1 68 436 5.0E-58
sp|B1IZI5|LLDD_ECOLC L-lactate dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=lldD PE=3 SV=1 68 436 5.0E-58
sp|A8A670|LLDD_ECOHS L-lactate dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=lldD PE=3 SV=1 68 436 5.0E-58
sp|B1X8M0|LLDD_ECODH L-lactate dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=lldD PE=3 SV=1 68 436 5.0E-58
sp|C4ZXJ7|LLDD_ECOBW L-lactate dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=lldD PE=3 SV=1 68 436 5.0E-58
sp|Q1R4Z0|LLDD_ECOUT L-lactate dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=lldD PE=3 SV=1 68 438 5.0E-58
sp|B7MFG9|LLDD_ECO45 L-lactate dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=lldD PE=3 SV=1 68 438 5.0E-58
sp|B2FIJ0|LLDD_STRMK L-lactate dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) GN=lldD PE=3 SV=1 68 435 6.0E-58
sp|Q3YVX0|LLDD_SHISS L-lactate dehydrogenase OS=Shigella sonnei (strain Ss046) GN=lldD PE=3 SV=1 68 436 6.0E-58
sp|Q83PP7|LLDD_SHIFL L-lactate dehydrogenase OS=Shigella flexneri GN=lldD PE=3 SV=1 68 436 6.0E-58
sp|Q0SYD1|LLDD_SHIF8 L-lactate dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=lldD PE=3 SV=1 68 436 6.0E-58
sp|B6I3I4|LLDD_ECOSE L-lactate dehydrogenase OS=Escherichia coli (strain SE11) GN=lldD PE=3 SV=1 68 436 6.0E-58
sp|B7M492|LLDD_ECO8A L-lactate dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=lldD PE=3 SV=1 68 436 6.0E-58
sp|B5YWA7|LLDD_ECO5E L-lactate dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=lldD PE=3 SV=1 68 436 6.0E-58
sp|Q8XDF7|LLDD_ECO57 L-lactate dehydrogenase OS=Escherichia coli O157:H7 GN=lldD PE=3 SV=1 68 436 6.0E-58
sp|B7L725|LLDD_ECO55 L-lactate dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=lldD PE=3 SV=1 68 436 6.0E-58
sp|A7ZTF9|LLDD_ECO24 L-lactate dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=lldD PE=3 SV=1 68 436 6.0E-58
sp|A7IMB0|LLDD_XANP2 L-lactate dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=lldD PE=3 SV=1 68 441 6.0E-58
sp|A1AHE2|LLDD_ECOK1 L-lactate dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=lldD PE=3 SV=1 68 438 1.0E-57
sp|Q7VPI9|LLDD_HAEDU L-lactate dehydrogenase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lldD PE=3 SV=1 68 435 1.0E-57
sp|Q329P9|LLDD_SHIDS L-lactate dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lldD PE=3 SV=1 68 436 1.0E-57
sp|Q6WB83|LLDD_ALCFA L-lactate dehydrogenase OS=Alcaligenes faecalis GN=lldD PE=3 SV=1 68 437 2.0E-57
sp|B7ULG1|LLDD_ECO27 L-lactate dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=lldD PE=3 SV=1 68 436 2.0E-57
sp|Q8FCB1|LLDD_ECOL6 L-lactate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lldD PE=3 SV=1 68 436 2.0E-57
sp|Q0TBK1|LLDD_ECOL5 L-lactate dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lldD PE=3 SV=1 68 436 2.0E-57
sp|B7NPB4|LLDD_ECO7I L-lactate dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=lldD PE=3 SV=1 68 436 2.0E-57
sp|B7N251|LLDD_ECO81 L-lactate dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=lldD PE=3 SV=1 68 436 2.0E-57
sp|Q31V17|LLDD_SHIBS L-lactate dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=lldD PE=3 SV=1 68 436 2.0E-57
sp|P20932|MDLB_PSEPU (S)-mandelate dehydrogenase OS=Pseudomonas putida GN=mdlB PE=1 SV=1 65 430 4.0E-57
sp|A8ARJ1|LLDD_CITK8 L-lactate dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=lldD PE=3 SV=1 68 435 4.0E-57
sp|Q7XPR4|GLO2_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Oryza sativa subsp. japonica GN=GLO2 PE=3 SV=3 69 432 1.0E-56
sp|Q01KC2|GLO2_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Oryza sativa subsp. indica GN=GLO2 PE=3 SV=2 69 432 1.0E-56
sp|A4XYG7|LLDD_PSEMY L-lactate dehydrogenase OS=Pseudomonas mendocina (strain ymp) GN=lldD PE=3 SV=1 68 435 4.0E-56
sp|B0V6L1|LLDD_ACIBY L-lactate dehydrogenase OS=Acinetobacter baumannii (strain AYE) GN=lldD PE=3 SV=1 68 435 4.0E-56
sp|A3M0X0|LLDD_ACIBT L-lactate dehydrogenase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=lldD PE=3 SV=2 68 435 4.0E-56
sp|B0VND0|LLDD_ACIBS L-lactate dehydrogenase OS=Acinetobacter baumannii (strain SDF) GN=lldD PE=3 SV=1 68 435 4.0E-56
sp|B2I061|LLDD_ACIBC L-lactate dehydrogenase OS=Acinetobacter baumannii (strain ACICU) GN=lldD PE=3 SV=1 68 435 4.0E-56
sp|B7IBS4|LLDD_ACIB5 L-lactate dehydrogenase OS=Acinetobacter baumannii (strain AB0057) GN=lldD PE=3 SV=1 68 435 4.0E-56
sp|B7H2H0|LLDD_ACIB3 L-lactate dehydrogenase OS=Acinetobacter baumannii (strain AB307-0294) GN=lldD PE=3 SV=1 68 435 4.0E-56
sp|B4T986|LLDD_SALHS L-lactate dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=lldD PE=3 SV=1 68 431 8.0E-56
sp|Q57ID8|LLDD_SALCH L-lactate dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=lldD PE=3 SV=1 68 431 8.0E-56
sp|Q6G4R2|LLDD_BARHE L-lactate dehydrogenase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=lldD PE=3 SV=1 80 435 9.0E-56
sp|Q8ZL61|LLDD_SALTY L-lactate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lldD PE=3 SV=1 68 431 9.0E-56
sp|B5FLH2|LLDD_SALDC L-lactate dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=lldD PE=3 SV=1 68 431 9.0E-56
sp|B5EXA8|LLDD_SALA4 L-lactate dehydrogenase OS=Salmonella agona (strain SL483) GN=lldD PE=3 SV=1 68 431 9.0E-56
sp|B4TZU7|LLDD_SALSV L-lactate dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=lldD PE=3 SV=1 68 431 9.0E-56
sp|A9MVJ5|LLDD_SALPB L-lactate dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=lldD PE=3 SV=1 68 431 1.0E-55
sp|A9MLC3|LLDD_SALAR L-lactate dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lldD PE=3 SV=1 68 431 1.0E-55
sp|B5RGI4|LLDD_SALG2 L-lactate dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=lldD PE=3 SV=1 68 431 1.0E-55
sp|B5R5C7|LLDD_SALEP L-lactate dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=lldD PE=3 SV=1 68 431 1.0E-55
sp|B5BHX7|LLDD_SALPK L-lactate dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=lldD PE=3 SV=1 68 431 1.0E-55
sp|Q5PLQ7|LLDD_SALPA L-lactate dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lldD PE=3 SV=1 68 431 1.0E-55
sp|A6TFK0|LLDD_KLEP7 L-lactate dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=lldD PE=3 SV=1 68 435 1.0E-55
sp|B5XMV0|LLDD_KLEP3 L-lactate dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=lldD PE=3 SV=1 68 435 2.0E-55
sp|C0Q1T7|LLDD_SALPC L-lactate dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=lldD PE=3 SV=1 68 431 2.0E-55
sp|B0KIT4|LLDD_PSEPG L-lactate dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=lldD PE=3 SV=1 68 437 2.0E-55
sp|P46454|LLDD_HAEIN L-lactate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lldD PE=3 SV=1 68 431 3.0E-55
sp|Q8Z2E5|LLDD_SALTI L-lactate dehydrogenase OS=Salmonella typhi GN=lldD PE=3 SV=1 68 431 4.0E-55
sp|A4W540|LLDD_ENT38 L-lactate dehydrogenase OS=Enterobacter sp. (strain 638) GN=lldD PE=3 SV=1 68 435 4.0E-55
sp|A5UFG9|LLDD_HAEIG L-lactate dehydrogenase OS=Haemophilus influenzae (strain PittGG) GN=lldD PE=3 SV=1 68 431 5.0E-55
sp|A5UBE3|LLDD_HAEIE L-lactate dehydrogenase OS=Haemophilus influenzae (strain PittEE) GN=lldD PE=3 SV=1 68 431 6.0E-55
sp|B4SXA4|LLDD_SALNS L-lactate dehydrogenase OS=Salmonella newport (strain SL254) GN=lldD PE=3 SV=1 68 431 8.0E-55
sp|Q4QJK8|LLDD_HAEI8 L-lactate dehydrogenase OS=Haemophilus influenzae (strain 86-028NP) GN=lldD PE=3 SV=1 68 431 1.0E-54
sp|C3LWP7|LLDD_VIBCM L-lactate dehydrogenase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=lldD PE=3 SV=1 68 437 1.0E-54
sp|Q9KKW6|LLDD_VIBCH L-lactate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lldD PE=3 SV=1 68 437 1.0E-54
sp|Q1IF69|LLDD_PSEE4 L-lactate dehydrogenase OS=Pseudomonas entomophila (strain L48) GN=lldD PE=3 SV=1 68 437 2.0E-54
sp|Q8PE75|LLDD_XANCP L-lactate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lldD PE=3 SV=1 68 438 4.0E-54
sp|Q4V0H2|LLDD_XANC8 L-lactate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lldD PE=3 SV=1 68 438 4.0E-54
sp|Q3BZH2|LLDD_XANC5 L-lactate dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lldD PE=3 SV=1 68 438 4.0E-54
sp|A9IN89|LLDD_BART1 L-lactate dehydrogenase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=lldD PE=3 SV=1 80 430 6.0E-54
sp|Q8PR33|LLDD_XANAC L-lactate dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lldD PE=3 SV=1 68 438 7.0E-54
sp|Q9HV37|LLDD_PSEAE L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lldD PE=3 SV=1 68 437 7.0E-54
sp|B7V1I3|LLDD_PSEA8 L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=lldD PE=3 SV=1 68 437 7.0E-54
sp|B0RLM2|LLDD_XANCB L-lactate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=lldD PE=3 SV=1 68 438 9.0E-54
sp|Q6FFS1|LLDD_ACIAD L-lactate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lldD PE=3 SV=1 68 435 9.0E-54
sp|Q88DT3|LLDD_PSEPK L-lactate dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=lldD PE=3 SV=1 68 437 1.0E-53
sp|A5W9B2|LLDD_PSEP1 L-lactate dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=lldD PE=3 SV=1 68 437 1.0E-53
sp|B1J244|LLDD_PSEPW L-lactate dehydrogenase OS=Pseudomonas putida (strain W619) GN=lldD PE=3 SV=1 68 437 2.0E-53
sp|A8HTC9|LLDD_AZOC5 L-lactate dehydrogenase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=lldD PE=3 SV=1 68 435 2.0E-53
sp|Q02FQ1|LLDD_PSEAB L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lldD PE=3 SV=1 68 437 2.0E-53
sp|Q5H6Z4|LLDD_XANOR L-lactate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lldD PE=3 SV=1 68 438 6.0E-53
sp|B2SUY3|LLDD_XANOP L-lactate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=lldD PE=3 SV=1 68 438 6.0E-53
sp|Q2P9K0|LLDD_XANOM L-lactate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lldD PE=3 SV=1 68 438 6.0E-53
sp|P9WND7|MFTD_MYCTU Putative mycofactocin system heme/flavin oxidoreductase MftD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mftD PE=1 SV=1 77 431 8.0E-53
sp|P9WND6|MFTD_MYCTO Putative mycofactocin system heme/flavin oxidoreductase MftD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mftD PE=3 SV=1 77 431 8.0E-53
sp|A6VCM8|LLDD_PSEA7 L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=lldD PE=3 SV=1 68 437 1.0E-52
sp|Q1R0J2|LLDD_CHRSD L-lactate dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lldD PE=3 SV=1 80 430 4.0E-52
sp|Q6G0J2|LLDD_BARQU L-lactate dehydrogenase OS=Bartonella quintana (strain Toulouse) GN=lldD PE=3 SV=1 80 435 5.0E-52
sp|P9WND5|LLDD_MYCTU Putative L-lactate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lldD PE=1 SV=1 74 430 1.0E-51
sp|P9WND4|LLDD_MYCTO Putative L-lactate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lldD PE=3 SV=1 74 430 1.0E-51
sp|B9K115|LLDD_AGRVS L-lactate dehydrogenase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=lldD PE=3 SV=1 68 436 2.0E-50
sp|O33655|LA2M_STRIN Lactate 2-monooxygenase OS=Streptococcus iniae GN=lctO PE=3 SV=1 76 444 9.0E-49
sp|A8GIL1|LLDD_SERP5 L-lactate dehydrogenase OS=Serratia proteamaculans (strain 568) GN=lldD PE=3 SV=1 68 431 4.0E-48
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 76 435 1.0E-47
sp|B0T7X2|LLDD_CAUSK L-lactate dehydrogenase OS=Caulobacter sp. (strain K31) GN=lldD PE=3 SV=1 68 435 2.0E-47
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 24 447 9.0E-44
sp|Q9A943|LLDD_CAUCR L-lactate dehydrogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lldD PE=3 SV=1 68 435 9.0E-44
sp|B8H3Q5|LLDD_CAUCN L-lactate dehydrogenase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lldD PE=3 SV=1 68 435 9.0E-44
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 74 431 3.0E-40
[Show less]

GO

GO Term Description Terminal node
GO:0006537 glutamate biosynthetic process Yes
GO:0016491 oxidoreductase activity Yes
GO:0018580 nitronate monooxygenase activity Yes
GO:0015930 glutamate synthase activity Yes
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors Yes
GO:0071704 organic substance metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0004497 monooxygenase activity No
GO:0006082 organic acid metabolic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0003824 catalytic activity No
GO:0046394 carboxylic acid biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0016703 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of one atom of oxygen (internal monooxygenases or internal mixed function oxidases) No
GO:0016053 organic acid biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043648 dicarboxylic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006536 glutamate metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009064 glutamine family amino acid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0043650 dicarboxylic acid biosynthetic process No
GO:0044237 cellular metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Peroxisomal targeting signal 0.345 0.1031 0.5618 0.1222 0.3861 0.1815 0.0534 0.1543 0.1177 0.1813

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.999704

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup384
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7362
Ophiocordyceps australis map64 (Brazil) OphauB2|2127
Ophiocordyceps camponoti-floridani Ophcf2|00352
Ophiocordyceps camponoti-rufipedis Ophun1|3655
Ophiocordyceps camponoti-rufipedis Ophun1|7224
Ophiocordyceps kimflemingae Ophio5|7457
Ophiocordyceps kimflemingae Ophio5|7458
Ophiocordyceps kimflemingae Ophio5|8136
Ophiocordyceps subramaniannii Hirsu2|1322 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1322
MKAAPASWAAAAAAILSLPLCSALDASAPPPPPPSDKMAPGDEHQTIPYGAHLLELIGRGVLHGQPPFVTTDPNK
LEAQAQKLMPTKGYDYIRSGAGESSTMDANRLAFRQWKIIPRVLQPTNPRDLSVTLFGHKYDTPVVMAPIGLHAL
YHPDKEIGTARACAALNVPFTLSTAASTGIEELVEGSPDGAKWFQLYWPTDEELTASILRRARSSGYRVLVVTLD
TWTLAWRPRDIDTANLPPLLGIGDDVGFQDPVFRSRFAQASDGARPEDQKVAAGAMWTRLTYPGVSHSWDELAIL
RRHWDGPIVLKGILSVDDARLAVQHGMDGIIVSNHGGRQIDGAVATLEVLPDIVDAVGGQISVLVDSGIRTGADI
VKALALGAKAVFVGRPVVYGLGINGTAGAQSVLHGLLADLDLTMGFAGVKRVSDLQRSLLRRVQYPGDVRANI*
Coding >Hirsu2|1322
ATGAAGGCGGCTCCGGCATCGTGGGCGGCAGCGGCAGCCGCCATCCTCAGTCTGCCTCTCTGCTCGGCCCTGGAC
GCCAGCGCGCCGCCGCCGCCTCCGCCATCGGACAAGATGGCGCCCGGCGACGAGCACCAGACGATACCGTACGGC
GCTCACCTGCTGGAGCTCATTGGCCGCGGCGTCCTCCACGGCCAGCCGCCCTTCGTCACGACAGACCCCAACAAG
CTCGAGGCCCAGGCCCAGAAGCTCATGCCGACCAAGGGCTATGACTACATCCGGAGCGGCGCGGGCGAGTCGTCC
ACCATGGACGCCAACCGCCTTGCCTTTCGCCAGTGGAAGATCATCCCGAGGGTGCTGCAGCCGACCAACCCCCGG
GACCTCAGCGTCACGCTCTTCGGACACAAGTACGACACGCCCGTCGTCATGGCCCCCATCGGCCTGCACGCCCTC
TACCACCCGGACAAGGAGATCGGCACGGCCCGGGCCTGTGCCGCGCTCAACGTGCCCTTCACCCTCAGCACCGCC
GCCTCGACCGGCATCGAGGAGCTTGTCGAGGGCAGCCCGGACGGCGCCAAGTGGTTCCAGCTGTACTGGCCGACG
GACGAGGAGCTGACGGCGTCGATCCTGCGTCGCGCCCGGAGCAGCGGGTACCGGGTGCTCGTCGTCACGCTCGAC
ACCTGGACGCTGGCCTGGCGACCGCGCGACATCGACACGGCCAACCTGCCGCCCCTGCTCGGCATAGGCGACGAC
GTCGGCTTCCAGGACCCCGTCTTCCGGAGCCGCTTCGCTCAGGCGAGCGACGGCGCCCGGCCGGAGGACCAGAAG
GTTGCCGCCGGCGCCATGTGGACGCGCCTGACGTACCCGGGCGTCAGCCACAGCTGGGACGAGCTCGCCATCCTG
CGCAGGCACTGGGACGGGCCCATCGTCCTCAAGGGCATCCTGAGCGTCGACGACGCCCGGCTGGCCGTCCAGCAC
GGCATGGACGGCATCATCGTCAGCAACCACGGCGGCCGCCAGATCGACGGCGCGGTGGCGACGCTCGAGGTGCTG
CCCGACATCGTCGACGCCGTCGGCGGCCAAATCTCCGTCCTCGTCGACTCGGGCATCCGCACCGGCGCCGACATT
GTCAAGGCGCTGGCCCTCGGCGCCAAGGCCGTCTTCGTCGGCCGGCCCGTCGTCTACGGCCTGGGCATCAACGGC
ACGGCCGGGGCCCAGTCCGTCCTGCACGGCCTCTTGGCCGATCTCGACCTCACCATGGGCTTCGCGGGCGTCAAG
CGCGTCTCGGACCTGCAGCGCTCGCTCCTCCGGAGGGTCCAATATCCGGGCGACGTCAGGGCCAACATCTAG
Transcript >Hirsu2|1322
ATGAAGGCGGCTCCGGCATCGTGGGCGGCAGCGGCAGCCGCCATCCTCAGTCTGCCTCTCTGCTCGGCCCTGGAC
GCCAGCGCGCCGCCGCCGCCTCCGCCATCGGACAAGATGGCGCCCGGCGACGAGCACCAGACGATACCGTACGGC
GCTCACCTGCTGGAGCTCATTGGCCGCGGCGTCCTCCACGGCCAGCCGCCCTTCGTCACGACAGACCCCAACAAG
CTCGAGGCCCAGGCCCAGAAGCTCATGCCGACCAAGGGCTATGACTACATCCGGAGCGGCGCGGGCGAGTCGTCC
ACCATGGACGCCAACCGCCTTGCCTTTCGCCAGTGGAAGATCATCCCGAGGGTGCTGCAGCCGACCAACCCCCGG
GACCTCAGCGTCACGCTCTTCGGACACAAGTACGACACGCCCGTCGTCATGGCCCCCATCGGCCTGCACGCCCTC
TACCACCCGGACAAGGAGATCGGCACGGCCCGGGCCTGTGCCGCGCTCAACGTGCCCTTCACCCTCAGCACCGCC
GCCTCGACCGGCATCGAGGAGCTTGTCGAGGGCAGCCCGGACGGCGCCAAGTGGTTCCAGCTGTACTGGCCGACG
GACGAGGAGCTGACGGCGTCGATCCTGCGTCGCGCCCGGAGCAGCGGGTACCGGGTGCTCGTCGTCACGCTCGAC
ACCTGGACGCTGGCCTGGCGACCGCGCGACATCGACACGGCCAACCTGCCGCCCCTGCTCGGCATAGGCGACGAC
GTCGGCTTCCAGGACCCCGTCTTCCGGAGCCGCTTCGCTCAGGCGAGCGACGGCGCCCGGCCGGAGGACCAGAAG
GTTGCCGCCGGCGCCATGTGGACGCGCCTGACGTACCCGGGCGTCAGCCACAGCTGGGACGAGCTCGCCATCCTG
CGCAGGCACTGGGACGGGCCCATCGTCCTCAAGGGCATCCTGAGCGTCGACGACGCCCGGCTGGCCGTCCAGCAC
GGCATGGACGGCATCATCGTCAGCAACCACGGCGGCCGCCAGATCGACGGCGCGGTGGCGACGCTCGAGGTGCTG
CCCGACATCGTCGACGCCGTCGGCGGCCAAATCTCCGTCCTCGTCGACTCGGGCATCCGCACCGGCGCCGACATT
GTCAAGGCGCTGGCCCTCGGCGCCAAGGCCGTCTTCGTCGGCCGGCCCGTCGTCTACGGCCTGGGCATCAACGGC
ACGGCCGGGGCCCAGTCCGTCCTGCACGGCCTCTTGGCCGATCTCGACCTCACCATGGGCTTCGCGGGCGTCAAG
CGCGTCTCGGACCTGCAGCGCTCGCTCCTCCGGAGGGTCCAATATCCGGGCGACGTCAGGGCCAACATCTAG
Gene >Hirsu2|1322
ATGAAGGCGGCTCCGGCATCGTGGGCGGCAGCGGCAGCCGCCATCCTCAGTCTGCCTCTCTGCTCGGCCCTGGAC
GCCAGCGCGCCGCCGCCGCCTCCGCCATCGGACAAGATGGCGCCCGGCGACGAGCACCAGACGATACCGTACGGC
GCTCACCTGCTGGAGCTCATTGGCCGCGGCGTCCTCCACGGCCAGCCGCCCTTCGTCACGACAGACCCCAACAAG
CTCGAGGCCCAGGCCCAGAAGCTCATGCCGACCAAGGGCTATGACTACATCCGGAGCGGCGCGGGCGAGTCGTCC
ACCATGGACGCCAACCGCCTTGCCTTTCGCCAGTGGAAGATCATCCCGAGGGTGCTGCAGCCGACCAACCCCCGG
GACCTCAGCGTCACGCTCTTCGGACACAAGTACGGTAAGGCTTCCGCATTTCGGCCTCCCCTGCCCCGTCTCCTG
CCGCCGCCGCCGCTCGGGATGCCGAAGGAGGCTCGCTGACCGGCCAAAGACACGCCCGTCGTCATGGCCCCCATC
GGCCTGCACGCCCTCTACCACCCGGACAAGGAGATCGGCACGGCCCGGGCCTGTGCCGCGCTCAACGTGCCCTTC
ACCCTCAGCACCGCCGCCTCGACCGGCATCGAGGAGCTTGTCGAGGGCAGCCCGGACGGCGCCAAGTGGTTCCAG
CTGTACTGGCCGACGGACGAGGAGCTGACGGCGTCGATCCTGCGTCGCGCCCGGAGCAGCGGGTACCGGGTGCTC
GTCGTCACGCTCGACACCTGGACGCTGGCCTGGCGACCGCGCGACATCGACACGGCCAACCTGCCGCCCCTGCTC
GGCATAGGCGACGACGTCGGCTTCCAGGACCCCGTCTTCCGGAGCCGCTTCGCTCAGGCGAGCGACGGCGCCCGG
CCGGAGGACCAGAAGGTTGCCGCCGGCGCCATGTGGACGCGCCTGACGTACCCGGGCGTCAGCCACAGCTGGGAC
GAGCTCGCCATCCTGCGCAGGCACTGGGACGGGCCCATCGTCCTCAAGGGCATCCTGAGCGTCGACGACGCCCGG
CTGGCCGTCCAGCACGGCATGGACGGCATCATCGTCAGCAACCACGGCGGCCGCCAGATCGACGGCGCGGTGGCG
ACGCTCGAGGTGCTGCCCGACATCGTCGACGCCGTCGGCGGCCAAATCTCCGTCCTCGTCGACTCGGGCATCCGC
ACCGGCGCCGACATTGTCAAGGCGCTGGCCCTCGGCGCCAAGGCCGTCTTCGTCGGCCGGCCCGTCGTCTACGGC
CTGGGCATCAACGGCACGGCCGGGGCCCAGTCCGTCCTGCACGGCCTCTTGGCCGATCTCGACCTCACCATGGGC
TTCGCGGGCGTCAAGCGCGTCTCGGACCTGCAGCGCTCGCTCCTCCGGAGGGTCCAATATCCGGGCGACGTCAGG
GCCAACATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail