Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1320
Gene name
LocationContig_129:18886..21433
Strand+
Gene length (bp)2547
Transcript length (bp)2547
Coding sequence length (bp)2547
Protein length (aa) 849

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00120 Gln-synt_C Glutamine synthetase, catalytic domain 3.1E-73 521 838
PF04909 Amidohydro_2 Amidohydrolase 2.4E-15 241 400

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38094|FLUG_EMENI Protein fluG OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fluG PE=1 SV=1 11 848 0.0E+00
sp|Q86B00|GLNA1_DICDI Type-1 glutamine synthetase 1 OS=Dictyostelium discoideum GN=glnA1 PE=3 SV=1 427 848 2.0E-37
sp|P36687|GLNA_PYRWO Glutamine synthetase 1 OS=Pyrococcus woesei GN=glnA PE=3 SV=1 427 848 9.0E-37
sp|O08467|GLNA_THEKO Glutamine synthetase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=glnA PE=1 SV=2 427 848 2.0E-36
sp|Q9UY99|GLNA_PYRAB Glutamine synthetase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glnA PE=3 SV=1 425 848 2.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38094|FLUG_EMENI Protein fluG OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fluG PE=1 SV=1 11 848 0.0E+00
sp|Q86B00|GLNA1_DICDI Type-1 glutamine synthetase 1 OS=Dictyostelium discoideum GN=glnA1 PE=3 SV=1 427 848 2.0E-37
sp|P36687|GLNA_PYRWO Glutamine synthetase 1 OS=Pyrococcus woesei GN=glnA PE=3 SV=1 427 848 9.0E-37
sp|O08467|GLNA_THEKO Glutamine synthetase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=glnA PE=1 SV=2 427 848 2.0E-36
sp|Q9UY99|GLNA_PYRAB Glutamine synthetase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glnA PE=3 SV=1 425 848 2.0E-36
sp|Q05907|GLNA_PYRFU Glutamine synthetase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=glnA PE=3 SV=2 427 848 1.0E-35
sp|O58097|GLNA_PYRHO Glutamine synthetase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=glnA PE=3 SV=1 423 848 1.0E-35
sp|Q60182|GLNA_METJA Glutamine synthetase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=glnA PE=3 SV=1 424 830 2.0E-34
sp|O59648|GLNA_METMP Glutamine synthetase OS=Methanococcus maripaludis (strain S2 / LL) GN=glnA PE=3 SV=1 424 848 8.0E-34
sp|Q8CSR8|GLNA_STAES Glutamine synthetase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glnA PE=3 SV=1 420 848 2.0E-33
sp|P60890|GLNA_STAAM Glutamine synthetase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glnA PE=3 SV=1 420 848 2.0E-33
sp|P99095|GLNA_STAAN Glutamine synthetase OS=Staphylococcus aureus (strain N315) GN=glnA PE=1 SV=1 420 848 2.0E-33
sp|Q5HPN2|GLNA_STAEQ Glutamine synthetase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glnA PE=3 SV=1 420 848 2.0E-33
sp|Q5HGC3|GLNA_STAAC Glutamine synthetase OS=Staphylococcus aureus (strain COL) GN=glnA PE=3 SV=1 420 848 2.0E-33
sp|Q6G9Q4|GLNA_STAAS Glutamine synthetase OS=Staphylococcus aureus (strain MSSA476) GN=glnA PE=3 SV=1 420 848 2.0E-33
sp|P0A040|GLNA_STAAU Glutamine synthetase OS=Staphylococcus aureus GN=glnA PE=3 SV=1 420 848 2.0E-33
sp|P0A039|GLNA_STAAW Glutamine synthetase OS=Staphylococcus aureus (strain MW2) GN=glnA PE=3 SV=1 420 848 2.0E-33
sp|P45627|GLNA_LACDE Glutamine synthetase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=glnA PE=3 SV=1 425 848 2.0E-33
sp|P12425|GLNA_BACSU Glutamine synthetase OS=Bacillus subtilis (strain 168) GN=glnA PE=1 SV=3 418 848 3.0E-33
sp|Q9HNI2|GLNA_HALSA Glutamine synthetase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=glnA PE=3 SV=1 428 848 5.0E-33
sp|Q6GHC6|GLNA_STAAR Glutamine synthetase OS=Staphylococcus aureus (strain MRSA252) GN=glnA PE=3 SV=1 420 848 5.0E-33
sp|P19064|GLNA_BACCE Glutamine synthetase OS=Bacillus cereus GN=glnA PE=1 SV=3 420 848 8.0E-33
sp|P43386|GLNA_HALVD Glutamine synthetase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=glnA PE=3 SV=2 428 848 5.0E-32
sp|O27612|GLNA_METTH Glutamine synthetase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=glnA PE=3 SV=1 426 848 6.0E-32
sp|P21154|GLNA_METVO Glutamine synthetase OS=Methanococcus voltae GN=glnA PE=3 SV=1 424 848 6.0E-32
sp|A0R083|GLNA2_MYCS2 Probable glutamine synthetase 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glnA PE=1 SV=1 510 828 9.0E-32
sp|P9WN37|GLNA2_MYCTU Probable glutamine synthetase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glnA2 PE=1 SV=1 510 828 2.0E-30
sp|P9WN36|GLNA2_MYCTO Probable glutamine synthetase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glnA2 PE=3 SV=1 510 828 2.0E-30
sp|P64246|GLNA2_MYCBO Probable glutamine synthetase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glnA2 PE=3 SV=1 510 828 2.0E-30
sp|P10656|GLNA_CLOSA Glutamine synthetase OS=Clostridium saccharobutylicum GN=glnA PE=3 SV=1 427 830 9.0E-30
sp|Q9CDL9|GLNA_LACLA Glutamine synthetase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glnA PE=3 SV=1 427 828 6.0E-28
sp|Q936T0|IPUC_PSESP Glutamate--isopropylamine ligase OS=Pseudomonas sp. GN=ipuC PE=1 SV=1 489 848 2.0E-27
sp|P36205|GLNA_THEMA Glutamine synthetase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glnA PE=3 SV=2 591 848 2.0E-27
sp|P0C7B6|GLNA2_DICDI Type-1 glutamine synthetase 2 OS=Dictyostelium discoideum GN=glnA2 PE=1 SV=1 428 848 3.0E-27
sp|O66514|GLNA_AQUAE Glutamine synthetase OS=Aquifex aeolicus (strain VF5) GN=glnA PE=3 SV=1 586 832 3.0E-25
sp|Q9ZLW5|GLNA_HELPJ Glutamine synthetase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=glnA PE=3 SV=1 578 825 5.0E-25
sp|P77958|GLNA1_STRFL Glutamine synthetase 1 OS=Streptomyces filamentosus GN=glnA PE=3 SV=1 591 826 6.0E-25
sp|P15106|GLNA_STRCO Glutamine synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glnA PE=2 SV=1 478 828 2.0E-24
sp|Q9HH09|GLNA_SULAC Glutamine synthetase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=glnA PE=1 SV=2 591 833 4.0E-24
sp|P94845|GLNA_HELPY Glutamine synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=glnA PE=3 SV=2 522 825 1.0E-23
sp|Q59747|GLNA1_RHIME Glutamine synthetase 1 OS=Rhizobium meliloti (strain 1021) GN=glnA PE=3 SV=2 578 828 2.0E-23
sp|P43794|GLNA_HAEIN Glutamine synthetase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glnA PE=3 SV=1 578 833 2.0E-23
sp|Q05542|GLNA1_STRVR Glutamine synthetase 1 OS=Streptomyces viridochromogenes GN=glnI PE=3 SV=1 591 826 4.0E-23
sp|Q9CLP2|GLNA_PASMU Glutamine synthetase OS=Pasteurella multocida (strain Pm70) GN=glnA PE=3 SV=1 578 833 5.0E-23
sp|P09826|GLNA1_RHILV Glutamine synthetase 1 OS=Rhizobium leguminosarum bv. viciae GN=glnA PE=3 SV=1 578 828 6.0E-23
sp|P05457|GLNA1_BRADU Glutamine synthetase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glnA PE=3 SV=2 577 833 7.0E-23
sp|P10583|GLNA_AZOBR Glutamine synthetase OS=Azospirillum brasilense GN=glnA PE=3 SV=1 578 835 7.0E-23
sp|P31592|GLNA3_RHILP Glutamine synthetase 3 OS=Rhizobium leguminosarum bv. phaseoli GN=glnT PE=1 SV=1 427 828 4.0E-22
sp|A9ZPH9|GMAS_METMY Glutamate--methylamine ligase OS=Methylovorus mays PE=1 SV=1 427 828 4.0E-22
sp|O87393|GLNA3_RHIME Glutamine synthetase 3 OS=Rhizobium meliloti (strain 1021) GN=glnT PE=1 SV=1 427 838 9.0E-22
sp|P25821|GLNA_NEIGO Glutamine synthetase OS=Neisseria gonorrhoeae GN=glnA PE=3 SV=1 588 828 1.0E-21
sp|P28786|GLNA_PROHU Glutamine synthetase OS=Proteus hauseri GN=glnA PE=3 SV=1 578 828 5.0E-21
sp|P0A1P6|GLNA_SALTY Glutamine synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glnA PE=1 SV=2 578 830 6.0E-21
sp|P0A1P7|GLNA_SALTI Glutamine synthetase OS=Salmonella typhi GN=glnA PE=3 SV=2 578 830 6.0E-21
sp|P19904|GLNA_VIBAL Glutamine synthetase OS=Vibrio alginolyticus GN=glnA PE=3 SV=1 591 830 9.0E-21
sp|P0A9C5|GLNA_ECOLI Glutamine synthetase OS=Escherichia coli (strain K12) GN=glnA PE=1 SV=2 578 830 2.0E-20
sp|P0A9C7|GLNA_ECO57 Glutamine synthetase OS=Escherichia coli O157:H7 GN=glnA PE=3 SV=2 578 830 2.0E-20
sp|P0A9C6|GLNA_ECOL6 Glutamine synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glnA PE=3 SV=2 578 830 2.0E-20
sp|P0A9C8|GLNA_SHIFL Glutamine synthetase OS=Shigella flexneri GN=glnA PE=3 SV=2 578 830 2.0E-20
sp|Q3V5W6|GLNA_PSETA Glutamine synthetase OS=Pseudomonas taetrolens GN=glnA PE=1 SV=1 591 828 3.0E-20
sp|Q46ZL2|3HAPM_CUPPJ 3-hydroxylaminophenol mutase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A2057 PE=1 SV=1 591 828 4.0E-20
sp|A0R079|GLNA1_MYCS2 Glutamine synthetase 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glnA PE=1 SV=1 585 826 5.0E-20
sp|F5RH07|GMAS_METUF Glutamate--methylamine ligase OS=Methyloversatilis universalis (strain ATCC BAA-1314 / JCM 13912 / FAM5) GN=gms PE=1 SV=1 524 828 1.0E-19
sp|P13499|GLNA_RHOCA Glutamine synthetase (Fragment) OS=Rhodobacter capsulatus GN=glnA PE=3 SV=2 535 806 2.0E-19
sp|P33035|GLNA_MICDP Glutamine synthetase OS=Microchaete diplosiphon GN=glnA PE=3 SV=2 578 825 2.0E-19
sp|P46033|GLNA1_FRAAL Glutamine synthetase 1 OS=Frankia alni GN=glnA PE=3 SV=1 470 826 3.0E-19
sp|P0A591|GLNA1_MYCBO Glutamine synthetase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glnA1 PE=3 SV=1 585 826 3.0E-19
sp|P9WN38|GLNA1_MYCTO Glutamine synthetase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glnA1 PE=3 SV=1 585 826 3.0E-19
sp|Q9KNJ2|GLNA_VIBCH Glutamine synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glnA PE=3 SV=1 591 830 3.0E-19
sp|P9WN39|GLNA1_MYCTU Glutamine synthetase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glnA1 PE=1 SV=1 585 826 3.0E-19
sp|P23794|GLNA_SULSO Glutamine synthetase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=glnA PE=3 SV=2 595 833 4.0E-19
sp|P15124|GLNA_METCA Glutamine synthetase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=glnA PE=3 SV=2 591 832 4.0E-19
sp|Q9HU65|GLNA_PSEAE Glutamine synthetase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glnA PE=1 SV=1 591 828 6.0E-19
sp|P94126|GLNA_AZOC5 Glutamine synthetase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=glnA PE=3 SV=2 578 833 7.0E-19
sp|P00964|GLNA_NOSS1 Glutamine synthetase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=glnA PE=1 SV=3 578 828 8.0E-19
sp|P22248|GLNA_AZOVI Glutamine synthetase OS=Azotobacter vinelandii GN=glnA PE=3 SV=1 591 828 1.0E-18
sp|P28605|GLNA_SYNP2 Glutamine synthetase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=glnA PE=3 SV=2 578 825 2.0E-18
sp|P77961|GLNA_SYNY3 Glutamine synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glnA PE=1 SV=2 578 825 4.0E-18
sp|P07804|GLNA_ACIFR Glutamine synthetase OS=Acidithiobacillus ferrooxidans GN=glnA PE=3 SV=1 644 832 6.0E-18
sp|O29313|GLNA_ARCFU Glutamine synthetase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=glnA PE=3 SV=1 491 828 4.0E-17
sp|P78061|PUUA_ECOLI Gamma-glutamylputrescine synthetase PuuA OS=Escherichia coli (strain K12) GN=puuA PE=1 SV=2 514 847 5.0E-16
sp|P43518|GLNA_RHOSH Glutamine synthetase OS=Rhodobacter sphaeroides GN=glnA PE=3 SV=1 578 829 3.0E-15
sp|Q8CIX8|LGSN_MOUSE Lengsin OS=Mus musculus GN=Lgsn PE=1 SV=1 581 848 2.0E-08
sp|Q7TT51|LGSN_RAT Lengsin OS=Rattus norvegicus GN=Lgsn PE=2 SV=1 581 848 3.0E-08
sp|Q1ZZS1|LGSN_CANLF Lengsin OS=Canis lupus familiaris GN=LGSN PE=2 SV=1 427 848 3.0E-08
sp|P51120|GLNA_TRITH Glutamine synthetase (Fragment) OS=Trichodesmium thiebautii GN=glnA PE=3 SV=1 598 704 1.0E-07
sp|Q5TDP6|LGSN_HUMAN Lengsin OS=Homo sapiens GN=LGSN PE=1 SV=1 581 848 2.0E-07
sp|Q0GA40|LGSN_RABIT Lengsin OS=Oryctolagus cuniculus GN=LGSN PE=2 SV=1 581 848 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004356 glutamate-ammonia ligase activity Yes
GO:0016787 hydrolase activity Yes
GO:0006807 nitrogen compound metabolic process Yes
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0016874 ligase activity No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0016211 ammonia ligase activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0016880 acid-ammonia (or amide) ligase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.7606 0.6826 0.1514 0.0384 0.0879 0.0062 0.072 0.0812 0.0514 0.0058

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup703
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6782
Ophiocordyceps australis map64 (Brazil) OphauB2|403
Ophiocordyceps camponoti-floridani Ophcf2|05960
Ophiocordyceps camponoti-rufipedis Ophun1|7275
Ophiocordyceps kimflemingae Ophio5|150
Ophiocordyceps subramaniannii Hirsu2|1320 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1320
MDSTAARGNEALLRAIRSTPIIDNHAHPLLRFDALGKKPLLSIASEAHGAALGSSRSGLAHLRAVRQLAALLGCE
CSWEAVVAAIDARRARSYDEWVSTCLSGIHCVLVDDGLDSTGDVEPYSNFNRFTAGAAKRIVRIEQVAAGLIEDV
CLRHDTAGEAFDAFARSYERAISQSILDPEVVAFKSVICYRTGLVIPRATPERCLSAFRAIFDRRRRPGAEVFGR
VDHPGINEELVHRLAILLSASERKKPIQFHTGLGDNDITLTSSSPAHLQAFIRQYPTVPIVLLHSGYPFVREAGY
LAAMYANVYADIGEVFPFLARGGQEEVVRQMLELCPSSKILWSTDGHWFPETYFLAVVQMRETFETVFCDCVRKG
DLTWQQAVRFVEDVLYHNSNELYKLRLSMPRPDAPGPAERGDELLAVGDTARFLRVCWNDMTATPRMRLIPIRRL
TSKLQSKEDLSFGVTKGCLGMIQTDVRIPGVDAVGEWRLCPDFGSLRAGPRQGHVTVMGDFRAEDGSLLALCPRT
LLKQALLAADREALSFALGFEIEVTLLRHTAACYVPLEGTGHAWSVSRAMDQDAAKAVIEEAVERLDAAGVYVEM
AHAESAPGQYEVVLPRAPPLQAVDTLLFAREVLACCAADNGYRATLYPKPVPGSCGTASHVHISITSRGGSDAAL
YEPFYGGILRHLRAIMAFTCSNLTSYERLVDGSWAGGTWVAWGTQNREAPLRKIEGSHWELKCMDGLANPYLALS
AILLAGLHGVRRGQELRWKDCGSEPASLSDEQRRRLGVEERLPSSVREALAALEEDVELGALLGQELVQRYVAVK
RAETDLLESMDSEARRRWIMERY*
Coding >Hirsu2|1320
ATGGACTCGACCGCCGCTCGCGGCAATGAAGCTCTGCTCCGCGCCATCCGGTCCACGCCCATCATCGACAACCAT
GCGCACCCCTTGCTGAGGTTCGATGCGCTGGGGAAGAAGCCGCTGCTTTCCATCGCCTCCGAGGCGCACGGCGCT
GCTCTCGGCTCCAGCAGATCGGGCTTGGCGCACCTGCGGGCCGTCAGGCAGCTCGCCGCCCTTCTCGGGTGCGAA
TGCTCGTGGGAAGCCGTCGTGGCCGCCATCGACGCGAGGCGCGCGCGCAGTTACGACGAATGGGTCAGCACCTGT
CTCTCCGGCATCCACTGCGTCCTCGTCGACGACGGCCTGGACAGCACGGGCGACGTCGAGCCGTACAGCAACTTC
AATCGCTTCACGGCCGGCGCTGCCAAGAGAATCGTCCGGATAGAGCAGGTCGCCGCGGGTCTAATCGAAGACGTG
TGCTTGCGCCACGACACGGCCGGCGAGGCATTCGACGCCTTTGCGCGCAGCTACGAACGGGCCATCTCACAGTCG
ATCCTGGACCCCGAAGTTGTCGCCTTCAAATCCGTCATCTGCTACCGCACGGGGCTGGTCATACCACGAGCGACG
CCAGAACGCTGCCTCTCGGCTTTTCGAGCCATCTTCGATCGACGGAGACGTCCCGGCGCAGAAGTCTTCGGCAGG
GTTGATCATCCCGGCATCAACGAAGAATTAGTGCACCGCTTGGCTATCCTCCTCAGCGCCAGCGAGCGCAAGAAG
CCGATCCAGTTTCACACGGGCCTGGGCGACAACGACATAACGCTGACGAGCTCCTCGCCCGCCCACCTGCAGGCC
TTCATCCGACAGTATCCCACGGTGCCGATCGTCCTGCTGCACTCCGGATACCCCTTTGTCCGCGAGGCTGGCTAT
CTGGCGGCCATGTACGCCAACGTCTATGCTGATATCGGCGAGGTGTTCCCCTTCCTCGCCAGAGGGGGACAGGAG
GAAGTGGTGCGGCAGATGCTGGAGCTCTGCCCATCGAGCAAGATCCTGTGGAGCACGGACGGTCATTGGTTTCCA
GAGACATACTTCCTTGCCGTGGTGCAGATGCGAGAGACCTTCGAGACGGTCTTCTGCGACTGTGTCCGCAAGGGC
GACTTGACCTGGCAGCAGGCCGTCCGCTTCGTCGAGGACGTGCTCTACCACAACTCGAACGAGCTGTACAAGCTG
CGGCTTTCGATGCCAAGGCCGGATGCGCCTGGGCCGGCGGAAAGGGGCGATGAGCTGCTGGCGGTCGGAGACACA
GCCCGGTTCTTGCGCGTCTGCTGGAACGACATGACGGCAACGCCGCGCATGAGGCTCATTCCGATCCGCCGTCTC
ACGTCCAAGTTGCAGAGCAAGGAGGACCTATCCTTCGGCGTGACCAAGGGTTGCCTGGGGATGATCCAGACGGAC
GTCCGGATCCCCGGCGTGGACGCCGTGGGCGAGTGGCGGCTGTGTCCGGACTTTGGCAGCCTCCGCGCCGGACCG
CGGCAAGGACATGTCACCGTCATGGGCGATTTCCGGGCCGAGGACGGCTCTCTGCTGGCCTTGTGCCCGAGAACG
TTGCTGAAGCAGGCGCTTCTCGCAGCCGATCGCGAGGCCTTGTCGTTCGCCCTGGGCTTCGAGATCGAGGTGACC
CTTCTCCGCCACACGGCGGCCTGTTACGTGCCCCTGGAAGGGACGGGCCACGCCTGGTCCGTATCCAGAGCCATG
GACCAGGACGCGGCCAAGGCAGTCATCGAGGAGGCCGTCGAGAGGCTGGACGCCGCGGGCGTCTACGTCGAGATG
GCGCACGCGGAAAGCGCCCCGGGGCAGTACGAGGTGGTGCTGCCCAGGGCGCCGCCGCTGCAAGCCGTAGACACC
CTCCTCTTCGCCCGCGAGGTCCTCGCGTGCTGCGCGGCGGACAACGGGTACAGGGCCACGCTCTACCCCAAGCCG
GTTCCCGGTAGCTGCGGGACAGCCAGCCACGTCCACATATCCATCACTTCTCGCGGCGGGTCGGACGCGGCTCTG
TATGAGCCGTTCTACGGTGGCATCCTGCGCCACCTGAGGGCCATCATGGCCTTCACCTGCAGCAACCTGACGAGC
TATGAGCGGCTCGTCGACGGCTCGTGGGCGGGCGGGACTTGGGTGGCCTGGGGGACGCAGAACCGCGAGGCGCCG
CTGCGCAAGATCGAGGGAAGCCACTGGGAGCTGAAGTGCATGGACGGGCTGGCCAACCCGTACCTGGCCCTGTCG
GCCATCCTGCTGGCCGGGCTGCACGGCGTGAGGCGGGGCCAGGAGCTGAGGTGGAAGGACTGCGGCTCGGAGCCG
GCCTCGCTGTCGGACGAGCAGAGGAGGCGGCTCGGGGTGGAGGAAAGGCTCCCTTCGAGCGTCAGGGAGGCGCTG
GCGGCCCTGGAAGAGGACGTCGAACTGGGCGCCTTGCTCGGCCAGGAGCTGGTGCAGCGATATGTCGCCGTCAAG
AGGGCCGAGACGGACCTGCTGGAGTCGATGGACAGCGAGGCGCGAAGGCGGTGGATCATGGAGCGATACTGA
Transcript >Hirsu2|1320
ATGGACTCGACCGCCGCTCGCGGCAATGAAGCTCTGCTCCGCGCCATCCGGTCCACGCCCATCATCGACAACCAT
GCGCACCCCTTGCTGAGGTTCGATGCGCTGGGGAAGAAGCCGCTGCTTTCCATCGCCTCCGAGGCGCACGGCGCT
GCTCTCGGCTCCAGCAGATCGGGCTTGGCGCACCTGCGGGCCGTCAGGCAGCTCGCCGCCCTTCTCGGGTGCGAA
TGCTCGTGGGAAGCCGTCGTGGCCGCCATCGACGCGAGGCGCGCGCGCAGTTACGACGAATGGGTCAGCACCTGT
CTCTCCGGCATCCACTGCGTCCTCGTCGACGACGGCCTGGACAGCACGGGCGACGTCGAGCCGTACAGCAACTTC
AATCGCTTCACGGCCGGCGCTGCCAAGAGAATCGTCCGGATAGAGCAGGTCGCCGCGGGTCTAATCGAAGACGTG
TGCTTGCGCCACGACACGGCCGGCGAGGCATTCGACGCCTTTGCGCGCAGCTACGAACGGGCCATCTCACAGTCG
ATCCTGGACCCCGAAGTTGTCGCCTTCAAATCCGTCATCTGCTACCGCACGGGGCTGGTCATACCACGAGCGACG
CCAGAACGCTGCCTCTCGGCTTTTCGAGCCATCTTCGATCGACGGAGACGTCCCGGCGCAGAAGTCTTCGGCAGG
GTTGATCATCCCGGCATCAACGAAGAATTAGTGCACCGCTTGGCTATCCTCCTCAGCGCCAGCGAGCGCAAGAAG
CCGATCCAGTTTCACACGGGCCTGGGCGACAACGACATAACGCTGACGAGCTCCTCGCCCGCCCACCTGCAGGCC
TTCATCCGACAGTATCCCACGGTGCCGATCGTCCTGCTGCACTCCGGATACCCCTTTGTCCGCGAGGCTGGCTAT
CTGGCGGCCATGTACGCCAACGTCTATGCTGATATCGGCGAGGTGTTCCCCTTCCTCGCCAGAGGGGGACAGGAG
GAAGTGGTGCGGCAGATGCTGGAGCTCTGCCCATCGAGCAAGATCCTGTGGAGCACGGACGGTCATTGGTTTCCA
GAGACATACTTCCTTGCCGTGGTGCAGATGCGAGAGACCTTCGAGACGGTCTTCTGCGACTGTGTCCGCAAGGGC
GACTTGACCTGGCAGCAGGCCGTCCGCTTCGTCGAGGACGTGCTCTACCACAACTCGAACGAGCTGTACAAGCTG
CGGCTTTCGATGCCAAGGCCGGATGCGCCTGGGCCGGCGGAAAGGGGCGATGAGCTGCTGGCGGTCGGAGACACA
GCCCGGTTCTTGCGCGTCTGCTGGAACGACATGACGGCAACGCCGCGCATGAGGCTCATTCCGATCCGCCGTCTC
ACGTCCAAGTTGCAGAGCAAGGAGGACCTATCCTTCGGCGTGACCAAGGGTTGCCTGGGGATGATCCAGACGGAC
GTCCGGATCCCCGGCGTGGACGCCGTGGGCGAGTGGCGGCTGTGTCCGGACTTTGGCAGCCTCCGCGCCGGACCG
CGGCAAGGACATGTCACCGTCATGGGCGATTTCCGGGCCGAGGACGGCTCTCTGCTGGCCTTGTGCCCGAGAACG
TTGCTGAAGCAGGCGCTTCTCGCAGCCGATCGCGAGGCCTTGTCGTTCGCCCTGGGCTTCGAGATCGAGGTGACC
CTTCTCCGCCACACGGCGGCCTGTTACGTGCCCCTGGAAGGGACGGGCCACGCCTGGTCCGTATCCAGAGCCATG
GACCAGGACGCGGCCAAGGCAGTCATCGAGGAGGCCGTCGAGAGGCTGGACGCCGCGGGCGTCTACGTCGAGATG
GCGCACGCGGAAAGCGCCCCGGGGCAGTACGAGGTGGTGCTGCCCAGGGCGCCGCCGCTGCAAGCCGTAGACACC
CTCCTCTTCGCCCGCGAGGTCCTCGCGTGCTGCGCGGCGGACAACGGGTACAGGGCCACGCTCTACCCCAAGCCG
GTTCCCGGTAGCTGCGGGACAGCCAGCCACGTCCACATATCCATCACTTCTCGCGGCGGGTCGGACGCGGCTCTG
TATGAGCCGTTCTACGGTGGCATCCTGCGCCACCTGAGGGCCATCATGGCCTTCACCTGCAGCAACCTGACGAGC
TATGAGCGGCTCGTCGACGGCTCGTGGGCGGGCGGGACTTGGGTGGCCTGGGGGACGCAGAACCGCGAGGCGCCG
CTGCGCAAGATCGAGGGAAGCCACTGGGAGCTGAAGTGCATGGACGGGCTGGCCAACCCGTACCTGGCCCTGTCG
GCCATCCTGCTGGCCGGGCTGCACGGCGTGAGGCGGGGCCAGGAGCTGAGGTGGAAGGACTGCGGCTCGGAGCCG
GCCTCGCTGTCGGACGAGCAGAGGAGGCGGCTCGGGGTGGAGGAAAGGCTCCCTTCGAGCGTCAGGGAGGCGCTG
GCGGCCCTGGAAGAGGACGTCGAACTGGGCGCCTTGCTCGGCCAGGAGCTGGTGCAGCGATATGTCGCCGTCAAG
AGGGCCGAGACGGACCTGCTGGAGTCGATGGACAGCGAGGCGCGAAGGCGGTGGATCATGGAGCGATACTGA
Gene >Hirsu2|1320
ATGGACTCGACCGCCGCTCGCGGCAATGAAGCTCTGCTCCGCGCCATCCGGTCCACGCCCATCATCGACAACCAT
GCGCACCCCTTGCTGAGGTTCGATGCGCTGGGGAAGAAGCCGCTGCTTTCCATCGCCTCCGAGGCGCACGGCGCT
GCTCTCGGCTCCAGCAGATCGGGCTTGGCGCACCTGCGGGCCGTCAGGCAGCTCGCCGCCCTTCTCGGGTGCGAA
TGCTCGTGGGAAGCCGTCGTGGCCGCCATCGACGCGAGGCGCGCGCGCAGTTACGACGAATGGGTCAGCACCTGT
CTCTCCGGCATCCACTGCGTCCTCGTCGACGACGGCCTGGACAGCACGGGCGACGTCGAGCCGTACAGCAACTTC
AATCGCTTCACGGCCGGCGCTGCCAAGAGAATCGTCCGGATAGAGCAGGTCGCCGCGGGTCTAATCGAAGACGTG
TGCTTGCGCCACGACACGGCCGGCGAGGCATTCGACGCCTTTGCGCGCAGCTACGAACGGGCCATCTCACAGTCG
ATCCTGGACCCCGAAGTTGTCGCCTTCAAATCCGTCATCTGCTACCGCACGGGGCTGGTCATACCACGAGCGACG
CCAGAACGCTGCCTCTCGGCTTTTCGAGCCATCTTCGATCGACGGAGACGTCCCGGCGCAGAAGTCTTCGGCAGG
GTTGATCATCCCGGCATCAACGAAGAATTAGTGCACCGCTTGGCTATCCTCCTCAGCGCCAGCGAGCGCAAGAAG
CCGATCCAGTTTCACACGGGCCTGGGCGACAACGACATAACGCTGACGAGCTCCTCGCCCGCCCACCTGCAGGCC
TTCATCCGACAGTATCCCACGGTGCCGATCGTCCTGCTGCACTCCGGATACCCCTTTGTCCGCGAGGCTGGCTAT
CTGGCGGCCATGTACGCCAACGTCTATGCTGATATCGGCGAGGTGTTCCCCTTCCTCGCCAGAGGGGGACAGGAG
GAAGTGGTGCGGCAGATGCTGGAGCTCTGCCCATCGAGCAAGATCCTGTGGAGCACGGACGGTCATTGGTTTCCA
GAGACATACTTCCTTGCCGTGGTGCAGATGCGAGAGACCTTCGAGACGGTCTTCTGCGACTGTGTCCGCAAGGGC
GACTTGACCTGGCAGCAGGCCGTCCGCTTCGTCGAGGACGTGCTCTACCACAACTCGAACGAGCTGTACAAGCTG
CGGCTTTCGATGCCAAGGCCGGATGCGCCTGGGCCGGCGGAAAGGGGCGATGAGCTGCTGGCGGTCGGAGACACA
GCCCGGTTCTTGCGCGTCTGCTGGAACGACATGACGGCAACGCCGCGCATGAGGCTCATTCCGATCCGCCGTCTC
ACGTCCAAGTTGCAGAGCAAGGAGGACCTATCCTTCGGCGTGACCAAGGGTTGCCTGGGGATGATCCAGACGGAC
GTCCGGATCCCCGGCGTGGACGCCGTGGGCGAGTGGCGGCTGTGTCCGGACTTTGGCAGCCTCCGCGCCGGACCG
CGGCAAGGACATGTCACCGTCATGGGCGATTTCCGGGCCGAGGACGGCTCTCTGCTGGCCTTGTGCCCGAGAACG
TTGCTGAAGCAGGCGCTTCTCGCAGCCGATCGCGAGGCCTTGTCGTTCGCCCTGGGCTTCGAGATCGAGGTGACC
CTTCTCCGCCACACGGCGGCCTGTTACGTGCCCCTGGAAGGGACGGGCCACGCCTGGTCCGTATCCAGAGCCATG
GACCAGGACGCGGCCAAGGCAGTCATCGAGGAGGCCGTCGAGAGGCTGGACGCCGCGGGCGTCTACGTCGAGATG
GCGCACGCGGAAAGCGCCCCGGGGCAGTACGAGGTGGTGCTGCCCAGGGCGCCGCCGCTGCAAGCCGTAGACACC
CTCCTCTTCGCCCGCGAGGTCCTCGCGTGCTGCGCGGCGGACAACGGGTACAGGGCCACGCTCTACCCCAAGCCG
GTTCCCGGTAGCTGCGGGACAGCCAGCCACGTCCACATATCCATCACTTCTCGCGGCGGGTCGGACGCGGCTCTG
TATGAGCCGTTCTACGGTGGCATCCTGCGCCACCTGAGGGCCATCATGGCCTTCACCTGCAGCAACCTGACGAGC
TATGAGCGGCTCGTCGACGGCTCGTGGGCGGGCGGGACTTGGGTGGCCTGGGGGACGCAGAACCGCGAGGCGCCG
CTGCGCAAGATCGAGGGAAGCCACTGGGAGCTGAAGTGCATGGACGGGCTGGCCAACCCGTACCTGGCCCTGTCG
GCCATCCTGCTGGCCGGGCTGCACGGCGTGAGGCGGGGCCAGGAGCTGAGGTGGAAGGACTGCGGCTCGGAGCCG
GCCTCGCTGTCGGACGAGCAGAGGAGGCGGCTCGGGGTGGAGGAAAGGCTCCCTTCGAGCGTCAGGGAGGCGCTG
GCGGCCCTGGAAGAGGACGTCGAACTGGGCGCCTTGCTCGGCCAGGAGCTGGTGCAGCGATATGTCGCCGTCAAG
AGGGCCGAGACGGACCTGCTGGAGTCGATGGACAGCGAGGCGCGAAGGCGGTGGATCATGGAGCGATACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail