© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|132 |
| Gene name | |
| Location | Contig_102:38280..38923 |
| Strand | - |
| Gene length (bp) | 643 |
| Transcript length (bp) | 540 |
| Coding sequence length (bp) | 540 |
| Protein length (aa) | 180 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00326 | Peptidase_S9 | Prolyl oligopeptidase family | 9.3E-39 | 3 | 150 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|E9ETL5|DAPB_METRA | Probable dipeptidyl-aminopeptidase B OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=DAPB PE=3 SV=2 | 1 | 170 | 8.0E-84 |
| sp|E9ED72|DAPB_METAQ | Probable dipeptidyl-aminopeptidase B OS=Metarhizium acridum (strain CQMa 102) GN=DAPB PE=3 SV=1 | 1 | 170 | 3.0E-78 |
| sp|C7YYG9|DAPB_NECH7 | Probable dipeptidyl-aminopeptidase B OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=DAPB PE=3 SV=1 | 2 | 160 | 3.0E-77 |
| sp|Q2HF90|DAPB_CHAGB | Probable dipeptidyl-aminopeptidase B OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DAPB PE=3 SV=1 | 3 | 166 | 8.0E-76 |
| sp|A4QYQ5|DAPB_MAGO7 | Probable dipeptidyl-aminopeptidase B OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DAPB PE=3 SV=1 | 1 | 176 | 1.0E-75 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|E9ETL5|DAPB_METRA | Probable dipeptidyl-aminopeptidase B OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=DAPB PE=3 SV=2 | 1 | 170 | 8.0E-84 |
| sp|E9ED72|DAPB_METAQ | Probable dipeptidyl-aminopeptidase B OS=Metarhizium acridum (strain CQMa 102) GN=DAPB PE=3 SV=1 | 1 | 170 | 3.0E-78 |
| sp|C7YYG9|DAPB_NECH7 | Probable dipeptidyl-aminopeptidase B OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=DAPB PE=3 SV=1 | 2 | 160 | 3.0E-77 |
| sp|Q2HF90|DAPB_CHAGB | Probable dipeptidyl-aminopeptidase B OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DAPB PE=3 SV=1 | 3 | 166 | 8.0E-76 |
| sp|A4QYQ5|DAPB_MAGO7 | Probable dipeptidyl-aminopeptidase B OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DAPB PE=3 SV=1 | 1 | 176 | 1.0E-75 |
| sp|D1Z9B4|DAPB_SORMK | Probable dipeptidyl-aminopeptidase B OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=DAPB PE=3 SV=1 | 3 | 162 | 3.0E-74 |
| sp|F0XS04|DAPB_GROCL | Probable dipeptidyl-aminopeptidase B OS=Grosmannia clavigera (strain kw1407 / UAMH 11150) GN=DAPB PE=3 SV=1 | 1 | 163 | 4.0E-74 |
| sp|Q7SHU8|DAPB_NEUCR | Probable dipeptidyl-aminopeptidase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dapB PE=3 SV=2 | 3 | 165 | 1.0E-73 |
| sp|C5FYZ3|DAPB_ARTOC | Probable dipeptidyl-aminopeptidase B OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=DAPB PE=3 SV=1 | 2 | 166 | 2.0E-73 |
| sp|E4UYL6|DAPB_ARTGP | Probable dipeptidyl-aminopeptidase B OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=DAPB PE=3 SV=1 | 2 | 169 | 2.0E-73 |
| sp|B2WC36|DAPB_PYRTR | Probable dipeptidyl-aminopeptidase B OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=dapB PE=3 SV=1 | 3 | 168 | 3.0E-72 |
| sp|C1FZL3|DAPB_PARBD | Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides brasiliensis (strain Pb18) GN=DAPB PE=3 SV=1 | 2 | 160 | 3.0E-72 |
| sp|C0S7H1|DAPB_PARBP | Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides brasiliensis (strain Pb03) GN=DAPB PE=3 SV=2 | 2 | 160 | 3.0E-72 |
| sp|B2A951|DAPB_PODAN | Probable dipeptidyl-aminopeptidase B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=DAPB PE=3 SV=1 | 3 | 160 | 5.0E-72 |
| sp|C1GT79|DAPB_PARBA | Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=DAPB PE=3 SV=1 | 2 | 160 | 2.0E-71 |
| sp|Q5B934|DAPB_EMENI | Probable dipeptidyl-aminopeptidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dapB PE=3 SV=2 | 2 | 177 | 2.0E-71 |
| sp|E3S9K3|DAPB_PYRTT | Probable dipeptidyl-aminopeptidase B OS=Pyrenophora teres f. teres (strain 0-1) GN=dapB PE=3 SV=1 | 3 | 168 | 5.0E-71 |
| sp|C4JHY5|DAPB_UNCRE | Probable dipeptidyl-aminopeptidase B OS=Uncinocarpus reesii (strain UAMH 1704) GN=DAPB PE=3 SV=1 | 2 | 174 | 8.0E-71 |
| sp|Q2UPW4|DAPB_ASPOR | Probable dipeptidyl-aminopeptidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dapB PE=3 SV=1 | 2 | 160 | 9.0E-71 |
| sp|B8N076|DAPB_ASPFN | Probable dipeptidyl-aminopeptidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dapB PE=3 SV=1 | 2 | 160 | 1.0E-70 |
| sp|E9CUF4|DAPB_COCPS | Probable dipeptidyl-aminopeptidase B OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=DAPB PE=3 SV=1 | 3 | 175 | 1.0E-70 |
| sp|C5P334|DAPB_COCP7 | Probable dipeptidyl-aminopeptidase B OS=Coccidioides posadasii (strain C735) GN=DAPB PE=3 SV=1 | 3 | 175 | 1.0E-70 |
| sp|Q96VT7|DAPB_ASPNG | Dipeptidyl-aminopeptidase B OS=Aspergillus niger GN=dapB PE=3 SV=1 | 2 | 160 | 2.0E-70 |
| sp|Q0UVK7|DAPB_PHANO | Probable dipeptidyl-aminopeptidase B OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DAPB PE=3 SV=1 | 3 | 167 | 2.0E-70 |
| sp|A2QEK7|DAPB_ASPNC | Probable dipeptidyl-aminopeptidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dapB PE=3 SV=1 | 2 | 160 | 2.0E-70 |
| sp|Q0CXB1|DAPB_ASPTN | Probable dipeptidyl-aminopeptidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dapB PE=3 SV=1 | 3 | 175 | 1.0E-69 |
| sp|A7EQZ1|DAPB_SCLS1 | Probable dipeptidyl-aminopeptidase B OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dapB PE=3 SV=1 | 3 | 161 | 3.0E-69 |
| sp|A6SL49|DAPB_BOTFB | Probable dipeptidyl-aminopeptidase B OS=Botryotinia fuckeliana (strain B05.10) GN=dapB PE=3 SV=1 | 3 | 161 | 6.0E-69 |
| sp|C5JC30|DAPB_AJEDS | Probable dipeptidyl-aminopeptidase B OS=Ajellomyces dermatitidis (strain SLH14081) GN=DAPB PE=3 SV=1 | 2 | 167 | 1.0E-68 |
| sp|C5GVF3|DAPB_AJEDR | Probable dipeptidyl-aminopeptidase B OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=DAPB PE=3 SV=1 | 2 | 167 | 1.0E-68 |
| sp|B0XYK8|DAPB_ASPFC | Probable dipeptidyl-aminopeptidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=dapB PE=3 SV=1 | 3 | 177 | 1.0E-68 |
| sp|Q4WX13|DAPB_ASPFU | Probable dipeptidyl-aminopeptidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dapB PE=3 SV=2 | 3 | 177 | 1.0E-68 |
| sp|C9SJ15|DAPB_VERA1 | Probable dipeptidyl-aminopeptidase B OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=DAPB PE=3 SV=1 | 6 | 160 | 2.0E-68 |
| sp|E3QKD2|DAPB_COLGM | Probable dipeptidyl-aminopeptidase B OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=DAPB PE=3 SV=1 | 3 | 167 | 4.0E-68 |
| sp|A1D7R6|DAPB_NEOFI | Probable dipeptidyl-aminopeptidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dapB PE=3 SV=1 | 3 | 177 | 9.0E-68 |
| sp|B6HFS8|DAPB_PENRW | Probable dipeptidyl-aminopeptidase B OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=dapB PE=3 SV=1 | 3 | 160 | 2.0E-67 |
| sp|C0NUQ8|DAPB_AJECG | Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=DAPB PE=3 SV=1 | 2 | 167 | 2.0E-67 |
| sp|A1CJQ1|DAPB_ASPCL | Probable dipeptidyl-aminopeptidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dapB PE=3 SV=1 | 3 | 168 | 3.0E-67 |
| sp|B8MTH6|DAPB_TALSN | Probable dipeptidyl-aminopeptidase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=dapB PE=3 SV=1 | 2 | 152 | 7.0E-67 |
| sp|C6HRC7|DAPB_AJECH | Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain H143) GN=DAPB PE=3 SV=1 | 2 | 160 | 7.0E-67 |
| sp|F0U7H7|DAPB_AJEC8 | Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain H88) GN=DAPB PE=3 SV=1 | 2 | 160 | 7.0E-67 |
| sp|A6RBI0|DAPB_AJECN | Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DAPB PE=3 SV=1 | 2 | 167 | 3.0E-66 |
| sp|D5GM60|DAPB_TUBMM | Probable dipeptidyl-aminopeptidase B OS=Tuber melanosporum (strain Mel28) GN=DAPB PE=3 SV=1 | 3 | 175 | 2.0E-65 |
| sp|B6QVW4|DAPB_TALMQ | Probable dipeptidyl-aminopeptidase B OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=dapB PE=3 SV=1 | 2 | 161 | 2.0E-65 |
| sp|P18962|DAP2_YEAST | Dipeptidyl aminopeptidase B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAP2 PE=1 SV=2 | 1 | 154 | 1.0E-63 |
| sp|D4AQT0|DAPB_ARTBC | Probable dipeptidyl-aminopeptidase B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=DAPB PE=3 SV=1 | 2 | 139 | 1.0E-59 |
| sp|D4DCG0|DAPB_TRIVH | Probable dipeptidyl-aminopeptidase B OS=Trichophyton verrucosum (strain HKI 0517) GN=DAPB PE=3 SV=1 | 2 | 139 | 2.0E-59 |
| sp|P33894|STE13_YEAST | Dipeptidyl aminopeptidase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE13 PE=1 SV=1 | 3 | 148 | 4.0E-53 |
| sp|O14073|YEA8_SCHPO | Putative dipeptidyl aminopeptidase C2E11.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.08 PE=3 SV=1 | 1 | 148 | 9.0E-49 |
| sp|Q4WPH9|DPP4_ASPFU | Probable dipeptidyl peptidase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dpp4 PE=3 SV=1 | 1 | 140 | 2.0E-35 |
| sp|B0Y6C5|DPP4_ASPFC | Probable dipeptidyl peptidase 4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=dpp4 PE=1 SV=1 | 1 | 140 | 2.0E-35 |
| sp|A1CX29|DPP4_NEOFI | Probable dipeptidyl peptidase 4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dpp4 PE=3 SV=1 | 1 | 140 | 3.0E-35 |
| sp|Q2UH35|DPP4_ASPOR | Dipeptidyl peptidase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dpp4 PE=1 SV=1 | 1 | 140 | 6.0E-33 |
| sp|B8N970|DPP4_ASPFN | Probable dipeptidyl peptidase 4 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dpp4 PE=3 SV=1 | 1 | 140 | 6.0E-33 |
| sp|A1CHP1|DPP4_ASPCL | Probable dipeptidyl peptidase 4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dpp4 PE=3 SV=1 | 1 | 140 | 3.0E-32 |
| sp|Q5AZ42|DPP4_EMENI | Probable dipeptidyl peptidase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dpp4 PE=3 SV=1 | 1 | 149 | 2.0E-31 |
| sp|P14740|DPP4_RAT | Dipeptidyl peptidase 4 OS=Rattus norvegicus GN=Dpp4 PE=1 SV=2 | 3 | 149 | 3.0E-28 |
| sp|P22411|DPP4_PIG | Dipeptidyl peptidase 4 OS=Sus scrofa GN=DPP4 PE=1 SV=3 | 3 | 149 | 3.0E-28 |
| sp|P81425|DPP4_BOVIN | Dipeptidyl peptidase 4 OS=Bos taurus GN=DPP4 PE=1 SV=3 | 3 | 149 | 3.0E-28 |
| sp|P28843|DPP4_MOUSE | Dipeptidyl peptidase 4 OS=Mus musculus GN=Dpp4 PE=1 SV=3 | 3 | 149 | 8.0E-28 |
| sp|A0S5V9|DPP4_ARTOT | Dipeptidyl peptidase 4 OS=Arthroderma otae GN=DPP4 PE=3 SV=1 | 5 | 140 | 2.0E-27 |
| sp|C5FJE3|DPP4_ARTOC | Dipeptidyl peptidase 4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=DPP4 PE=3 SV=2 | 5 | 140 | 2.0E-27 |
| sp|P27487|DPP4_HUMAN | Dipeptidyl peptidase 4 OS=Homo sapiens GN=DPP4 PE=1 SV=2 | 3 | 149 | 3.0E-27 |
| sp|Q9N2I7|DPP4_FELCA | Dipeptidyl peptidase 4 OS=Felis catus GN=DPP4 PE=2 SV=1 | 3 | 149 | 5.0E-27 |
| sp|D4APE2|DPP4_ARTBC | Probable dipeptidyl peptidase 4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=DPP4 PE=1 SV=1 | 5 | 171 | 1.0E-26 |
| sp|B1A4F7|VDDP4_VESVU | Venom dipeptidyl peptidase 4 OS=Vespula vulgaris PE=1 SV=1 | 1 | 127 | 2.0E-26 |
| sp|B6V868|DPP4_TRITO | Dipeptidyl peptidase 4 OS=Trichophyton tonsurans GN=DPP4 PE=3 SV=1 | 5 | 171 | 3.0E-26 |
| sp|A7UKV8|DPP4_TRIEQ | Dipeptidyl peptidase 4 OS=Trichophyton equinum GN=DPP4 PE=3 SV=1 | 5 | 171 | 3.0E-26 |
| sp|B2D0J4|VDPP4_APIME | Venom dipeptidyl peptidase 4 OS=Apis mellifera PE=1 SV=1 | 3 | 127 | 5.0E-25 |
| sp|Q5J6J3|DPP4_TRIRU | Dipeptidyl peptidase 4 OS=Trichophyton rubrum GN=DPP4 PE=1 SV=1 | 5 | 171 | 6.0E-25 |
| sp|P97321|SEPR_MOUSE | Prolyl endopeptidase FAP OS=Mus musculus GN=Fap PE=1 SV=1 | 3 | 149 | 2.0E-24 |
| sp|Q12884|SEPR_HUMAN | Prolyl endopeptidase FAP OS=Homo sapiens GN=FAP PE=1 SV=5 | 3 | 149 | 3.0E-24 |
| sp|A5D7B7|SEPR_BOVIN | Prolyl endopeptidase FAP OS=Bos taurus GN=FAP PE=1 SV=1 | 3 | 128 | 9.0E-24 |
| sp|Q6F3I7|DAP4_PSEMX | Dipeptidyl aminopeptidase 4 OS=Pseudoxanthomonas mexicana GN=dap4 PE=1 SV=1 | 3 | 127 | 1.0E-23 |
| sp|Q18253|DPF2_CAEEL | Dipeptidyl peptidase family member 2 OS=Caenorhabditis elegans GN=dpf-2 PE=1 SV=1 | 3 | 146 | 2.0E-23 |
| sp|Q8N608|DPP10_HUMAN | Inactive dipeptidyl peptidase 10 OS=Homo sapiens GN=DPP10 PE=1 SV=2 | 1 | 128 | 4.0E-23 |
| sp|Q7JKY3|DPF1_CAEEL | Dipeptidyl peptidase family member 1 OS=Caenorhabditis elegans GN=dpf-1 PE=1 SV=1 | 4 | 128 | 2.0E-22 |
| sp|Q9P7E9|YDZF_SCHPO | Putative dipeptidyl aminopeptidase C14C4.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC14C4.15c PE=3 SV=2 | 2 | 128 | 2.0E-22 |
| sp|Q6V1X1|DPP8_HUMAN | Dipeptidyl peptidase 8 OS=Homo sapiens GN=DPP8 PE=1 SV=1 | 3 | 127 | 2.0E-21 |
| sp|Q8BVG4|DPP9_MOUSE | Dipeptidyl peptidase 9 OS=Mus musculus GN=Dpp9 PE=1 SV=2 | 3 | 127 | 2.0E-21 |
| sp|Q6NXK7|DPP10_MOUSE | Inactive dipeptidyl peptidase 10 OS=Mus musculus GN=Dpp10 PE=1 SV=1 | 2 | 128 | 2.0E-21 |
| sp|Q6Q629|DPP10_RAT | Inactive dipeptidyl peptidase 10 OS=Rattus norvegicus GN=Dpp10 PE=1 SV=1 | 2 | 128 | 2.0E-21 |
| sp|Q80YA7|DPP8_MOUSE | Dipeptidyl peptidase 8 OS=Mus musculus GN=Dpp8 PE=1 SV=1 | 3 | 127 | 4.0E-21 |
| sp|Q86TI2|DPP9_HUMAN | Dipeptidyl peptidase 9 OS=Homo sapiens GN=DPP9 PE=1 SV=3 | 3 | 127 | 5.0E-21 |
| sp|Q5IS50|DPP6_PANTR | Dipeptidyl aminopeptidase-like protein 6 OS=Pan troglodytes GN=DPP6 PE=2 SV=1 | 3 | 148 | 2.0E-20 |
| sp|P42658|DPP6_HUMAN | Dipeptidyl aminopeptidase-like protein 6 OS=Homo sapiens GN=DPP6 PE=1 SV=2 | 3 | 148 | 4.0E-20 |
| sp|D4CZ59|DPP4_TRIVH | Probable dipeptidyl peptidase 4 OS=Trichophyton verrucosum (strain HKI 0517) GN=DPP4 PE=3 SV=1 | 5 | 171 | 1.0E-19 |
| sp|Q9Z218|DPP6_MOUSE | Dipeptidyl aminopeptidase-like protein 6 OS=Mus musculus GN=Dpp6 PE=1 SV=1 | 3 | 131 | 1.0E-18 |
| sp|P46101|DPP6_RAT | Dipeptidyl aminopeptidase-like protein 6 OS=Rattus norvegicus GN=Dpp6 PE=1 SV=1 | 3 | 131 | 2.0E-18 |
| sp|P42659|DPP6_BOVIN | Dipeptidyl aminopeptidase-like protein 6 OS=Bos taurus GN=DPP6 PE=1 SV=1 | 2 | 128 | 3.0E-18 |
| sp|Q7MUW6|PTP_PORGI | Prolyl tripeptidyl peptidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=ptpA PE=1 SV=1 | 3 | 127 | 3.0E-15 |
| sp|B2RJX3|PTP_PORG3 | Prolyl tripeptidyl peptidase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=ptpA PE=3 SV=1 | 3 | 127 | 3.0E-15 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0006508 | proteolysis | Yes |
| GO:0008236 | serine-type peptidase activity | Yes |
| GO:0140096 | catalytic activity, acting on a protein | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0008233 | peptidase activity | No |
| GO:0003824 | catalytic activity | No |
| GO:0008152 | metabolic process | No |
| GO:0019538 | protein metabolic process | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:0044238 | primary metabolic process | No |
| GO:0017171 | serine hydrolase activity | No |
| GO:0016787 | hydrolase activity | No |
| GO:0003674 | molecular_function | No |
| GO:0008150 | biological_process | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Extracellular | Signal peptide | 0.3433 | 0.132 | 0.6061 | 0.4588 | 0.3191 | 0.1502 | 0.3777 | 0.3128 | 0.4938 | 0.0796 |
| Orthofinder run ID | 4 |
| Orthogroup | 269 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|132 LPYVDPARLAIWGWSYGGFAALKTLEQDAGATFGYGMAVAPVTDWRFYDSVYTERYMRLPADNAAGYAASRVANA SALGAATRFLLVHGAADDNVHLQNSLHLLDDLDRAGVRNYDVHLFPDSDHSISFHNANRIVYYKLRDWLVNAFNG EWLKTKDPEPIGRLRARFVAARRALWPRP* |
| Coding | >Hirsu2|132 CTGCCCTACGTCGACCCGGCCCGGCTCGCCATCTGGGGCTGGTCGTACGGCGGCTTCGCCGCGCTCAAGACGCTC GAGCAGGACGCCGGCGCCACCTTCGGCTACGGCATGGCCGTCGCCCCCGTCACCGACTGGCGCTTCTACGACTCC GTCTACACGGAGCGCTACATGCGCCTGCCCGCCGACAACGCCGCCGGCTACGCCGCCTCGCGCGTCGCCAACGCC TCCGCCCTCGGCGCCGCCACCCGCTTCCTGCTCGTCCACGGCGCCGCCGACGACAACGTCCACCTGCAGAACTCG CTGCACCTGCTCGACGACCTCGACCGCGCCGGCGTCCGCAACTACGACGTCCACCTCTTCCCGGACTCGGACCAC AGCATCTCCTTCCACAACGCCAACCGCATCGTCTACTACAAACTGCGCGACTGGCTCGTCAACGCCTTCAATGGC GAGTGGCTCAAGACCAAGGACCCCGAGCCCATCGGCCGGCTGCGTGCTCGCTTCGTCGCCGCCCGCCGCGCCCTG TGGCCGCGCCCGTGA |
| Transcript | >Hirsu2|132 CTGCCCTACGTCGACCCGGCCCGGCTCGCCATCTGGGGCTGGTCGTACGGCGGCTTCGCCGCGCTCAAGACGCTC GAGCAGGACGCCGGCGCCACCTTCGGCTACGGCATGGCCGTCGCCCCCGTCACCGACTGGCGCTTCTACGACTCC GTCTACACGGAGCGCTACATGCGCCTGCCCGCCGACAACGCCGCCGGCTACGCCGCCTCGCGCGTCGCCAACGCC TCCGCCCTCGGCGCCGCCACCCGCTTCCTGCTCGTCCACGGCGCCGCCGACGACAACGTCCACCTGCAGAACTCG CTGCACCTGCTCGACGACCTCGACCGCGCCGGCGTCCGCAACTACGACGTCCACCTCTTCCCGGACTCGGACCAC AGCATCTCCTTCCACAACGCCAACCGCATCGTCTACTACAAACTGCGCGACTGGCTCGTCAACGCCTTCAATGGC GAGTGGCTCAAGACCAAGGACCCCGAGCCCATCGGCCGGCTGCGTGCTCGCTTCGTCGCCGCCCGCCGCGCCCTG TGGCCGCGCCCGTGA |
| Gene | >Hirsu2|132 CTGCCCTACGTCGACCCGGCCCGGCTCGCCATCTGGGGCTGGTCGTACGGCGGCTTCGCCGCGCTCAAGACGCTC GAGCAGGACGCCGGCGCCACCTTCGGCTACGGCATGGCCGTCGCCCCCGTCACCGACTGGCGCTTCTACGACTCC GTCTACACGGAGCGCTACATGCGCCTGCCCGCCGACAACGCCGCCGGCTACGCCGCCTCGCGCGTCGCCAACGCC TCCGCCCTCGGCGCCGCCACCCGCTTCCTGCTCGTCCACGGCGCCGCCGACGACAACGTCCACCTGCAGAACTCG CTGCACCTGCTCGACGACCTCGACCGCGCCGGCGTCCGCAACTACGACGTCCACCTCTTCCCGGACTCGGACCAC AGCATCTCCTTCCACAACGCCAACCGCATCGTCTACTACAGTGAGCTCTCCTTCTTCCCTTTTCGCTCTCCCTCT CTTCTCTTCTTTTTTGCTCTTCGCCTTCTTCATCTTTCCCCCGCCGCTGATTCGTCCCCCCGTCGCAGAACTGCG CGACTGGCTCGTCAACGCCTTCAATGGCGAGTGGCTCAAGACCAAGGACCCCGAGCCCATCGGCCGGCTGCGTGC TCGCTTCGTCGCCGCCCGCCGCGCCCTGTGGCCGCGCCCGTGA |