Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|132
Gene name
LocationContig_102:38280..38923
Strand-
Gene length (bp)643
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00326 Peptidase_S9 Prolyl oligopeptidase family 9.3E-39 3 150

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E9ETL5|DAPB_METRA Probable dipeptidyl-aminopeptidase B OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=DAPB PE=3 SV=2 1 170 8.0E-84
sp|E9ED72|DAPB_METAQ Probable dipeptidyl-aminopeptidase B OS=Metarhizium acridum (strain CQMa 102) GN=DAPB PE=3 SV=1 1 170 3.0E-78
sp|C7YYG9|DAPB_NECH7 Probable dipeptidyl-aminopeptidase B OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=DAPB PE=3 SV=1 2 160 3.0E-77
sp|Q2HF90|DAPB_CHAGB Probable dipeptidyl-aminopeptidase B OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DAPB PE=3 SV=1 3 166 8.0E-76
sp|A4QYQ5|DAPB_MAGO7 Probable dipeptidyl-aminopeptidase B OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DAPB PE=3 SV=1 1 176 1.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E9ETL5|DAPB_METRA Probable dipeptidyl-aminopeptidase B OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=DAPB PE=3 SV=2 1 170 8.0E-84
sp|E9ED72|DAPB_METAQ Probable dipeptidyl-aminopeptidase B OS=Metarhizium acridum (strain CQMa 102) GN=DAPB PE=3 SV=1 1 170 3.0E-78
sp|C7YYG9|DAPB_NECH7 Probable dipeptidyl-aminopeptidase B OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=DAPB PE=3 SV=1 2 160 3.0E-77
sp|Q2HF90|DAPB_CHAGB Probable dipeptidyl-aminopeptidase B OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DAPB PE=3 SV=1 3 166 8.0E-76
sp|A4QYQ5|DAPB_MAGO7 Probable dipeptidyl-aminopeptidase B OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DAPB PE=3 SV=1 1 176 1.0E-75
sp|D1Z9B4|DAPB_SORMK Probable dipeptidyl-aminopeptidase B OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=DAPB PE=3 SV=1 3 162 3.0E-74
sp|F0XS04|DAPB_GROCL Probable dipeptidyl-aminopeptidase B OS=Grosmannia clavigera (strain kw1407 / UAMH 11150) GN=DAPB PE=3 SV=1 1 163 4.0E-74
sp|Q7SHU8|DAPB_NEUCR Probable dipeptidyl-aminopeptidase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dapB PE=3 SV=2 3 165 1.0E-73
sp|C5FYZ3|DAPB_ARTOC Probable dipeptidyl-aminopeptidase B OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=DAPB PE=3 SV=1 2 166 2.0E-73
sp|E4UYL6|DAPB_ARTGP Probable dipeptidyl-aminopeptidase B OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=DAPB PE=3 SV=1 2 169 2.0E-73
sp|B2WC36|DAPB_PYRTR Probable dipeptidyl-aminopeptidase B OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=dapB PE=3 SV=1 3 168 3.0E-72
sp|C1FZL3|DAPB_PARBD Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides brasiliensis (strain Pb18) GN=DAPB PE=3 SV=1 2 160 3.0E-72
sp|C0S7H1|DAPB_PARBP Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides brasiliensis (strain Pb03) GN=DAPB PE=3 SV=2 2 160 3.0E-72
sp|B2A951|DAPB_PODAN Probable dipeptidyl-aminopeptidase B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=DAPB PE=3 SV=1 3 160 5.0E-72
sp|C1GT79|DAPB_PARBA Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=DAPB PE=3 SV=1 2 160 2.0E-71
sp|Q5B934|DAPB_EMENI Probable dipeptidyl-aminopeptidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dapB PE=3 SV=2 2 177 2.0E-71
sp|E3S9K3|DAPB_PYRTT Probable dipeptidyl-aminopeptidase B OS=Pyrenophora teres f. teres (strain 0-1) GN=dapB PE=3 SV=1 3 168 5.0E-71
sp|C4JHY5|DAPB_UNCRE Probable dipeptidyl-aminopeptidase B OS=Uncinocarpus reesii (strain UAMH 1704) GN=DAPB PE=3 SV=1 2 174 8.0E-71
sp|Q2UPW4|DAPB_ASPOR Probable dipeptidyl-aminopeptidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dapB PE=3 SV=1 2 160 9.0E-71
sp|B8N076|DAPB_ASPFN Probable dipeptidyl-aminopeptidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dapB PE=3 SV=1 2 160 1.0E-70
sp|E9CUF4|DAPB_COCPS Probable dipeptidyl-aminopeptidase B OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=DAPB PE=3 SV=1 3 175 1.0E-70
sp|C5P334|DAPB_COCP7 Probable dipeptidyl-aminopeptidase B OS=Coccidioides posadasii (strain C735) GN=DAPB PE=3 SV=1 3 175 1.0E-70
sp|Q96VT7|DAPB_ASPNG Dipeptidyl-aminopeptidase B OS=Aspergillus niger GN=dapB PE=3 SV=1 2 160 2.0E-70
sp|Q0UVK7|DAPB_PHANO Probable dipeptidyl-aminopeptidase B OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DAPB PE=3 SV=1 3 167 2.0E-70
sp|A2QEK7|DAPB_ASPNC Probable dipeptidyl-aminopeptidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dapB PE=3 SV=1 2 160 2.0E-70
sp|Q0CXB1|DAPB_ASPTN Probable dipeptidyl-aminopeptidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dapB PE=3 SV=1 3 175 1.0E-69
sp|A7EQZ1|DAPB_SCLS1 Probable dipeptidyl-aminopeptidase B OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dapB PE=3 SV=1 3 161 3.0E-69
sp|A6SL49|DAPB_BOTFB Probable dipeptidyl-aminopeptidase B OS=Botryotinia fuckeliana (strain B05.10) GN=dapB PE=3 SV=1 3 161 6.0E-69
sp|C5JC30|DAPB_AJEDS Probable dipeptidyl-aminopeptidase B OS=Ajellomyces dermatitidis (strain SLH14081) GN=DAPB PE=3 SV=1 2 167 1.0E-68
sp|C5GVF3|DAPB_AJEDR Probable dipeptidyl-aminopeptidase B OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=DAPB PE=3 SV=1 2 167 1.0E-68
sp|B0XYK8|DAPB_ASPFC Probable dipeptidyl-aminopeptidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=dapB PE=3 SV=1 3 177 1.0E-68
sp|Q4WX13|DAPB_ASPFU Probable dipeptidyl-aminopeptidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dapB PE=3 SV=2 3 177 1.0E-68
sp|C9SJ15|DAPB_VERA1 Probable dipeptidyl-aminopeptidase B OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=DAPB PE=3 SV=1 6 160 2.0E-68
sp|E3QKD2|DAPB_COLGM Probable dipeptidyl-aminopeptidase B OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=DAPB PE=3 SV=1 3 167 4.0E-68
sp|A1D7R6|DAPB_NEOFI Probable dipeptidyl-aminopeptidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dapB PE=3 SV=1 3 177 9.0E-68
sp|B6HFS8|DAPB_PENRW Probable dipeptidyl-aminopeptidase B OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=dapB PE=3 SV=1 3 160 2.0E-67
sp|C0NUQ8|DAPB_AJECG Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=DAPB PE=3 SV=1 2 167 2.0E-67
sp|A1CJQ1|DAPB_ASPCL Probable dipeptidyl-aminopeptidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dapB PE=3 SV=1 3 168 3.0E-67
sp|B8MTH6|DAPB_TALSN Probable dipeptidyl-aminopeptidase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=dapB PE=3 SV=1 2 152 7.0E-67
sp|C6HRC7|DAPB_AJECH Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain H143) GN=DAPB PE=3 SV=1 2 160 7.0E-67
sp|F0U7H7|DAPB_AJEC8 Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain H88) GN=DAPB PE=3 SV=1 2 160 7.0E-67
sp|A6RBI0|DAPB_AJECN Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DAPB PE=3 SV=1 2 167 3.0E-66
sp|D5GM60|DAPB_TUBMM Probable dipeptidyl-aminopeptidase B OS=Tuber melanosporum (strain Mel28) GN=DAPB PE=3 SV=1 3 175 2.0E-65
sp|B6QVW4|DAPB_TALMQ Probable dipeptidyl-aminopeptidase B OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=dapB PE=3 SV=1 2 161 2.0E-65
sp|P18962|DAP2_YEAST Dipeptidyl aminopeptidase B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAP2 PE=1 SV=2 1 154 1.0E-63
sp|D4AQT0|DAPB_ARTBC Probable dipeptidyl-aminopeptidase B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=DAPB PE=3 SV=1 2 139 1.0E-59
sp|D4DCG0|DAPB_TRIVH Probable dipeptidyl-aminopeptidase B OS=Trichophyton verrucosum (strain HKI 0517) GN=DAPB PE=3 SV=1 2 139 2.0E-59
sp|P33894|STE13_YEAST Dipeptidyl aminopeptidase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE13 PE=1 SV=1 3 148 4.0E-53
sp|O14073|YEA8_SCHPO Putative dipeptidyl aminopeptidase C2E11.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.08 PE=3 SV=1 1 148 9.0E-49
sp|Q4WPH9|DPP4_ASPFU Probable dipeptidyl peptidase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dpp4 PE=3 SV=1 1 140 2.0E-35
sp|B0Y6C5|DPP4_ASPFC Probable dipeptidyl peptidase 4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=dpp4 PE=1 SV=1 1 140 2.0E-35
sp|A1CX29|DPP4_NEOFI Probable dipeptidyl peptidase 4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dpp4 PE=3 SV=1 1 140 3.0E-35
sp|Q2UH35|DPP4_ASPOR Dipeptidyl peptidase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dpp4 PE=1 SV=1 1 140 6.0E-33
sp|B8N970|DPP4_ASPFN Probable dipeptidyl peptidase 4 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dpp4 PE=3 SV=1 1 140 6.0E-33
sp|A1CHP1|DPP4_ASPCL Probable dipeptidyl peptidase 4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dpp4 PE=3 SV=1 1 140 3.0E-32
sp|Q5AZ42|DPP4_EMENI Probable dipeptidyl peptidase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dpp4 PE=3 SV=1 1 149 2.0E-31
sp|P14740|DPP4_RAT Dipeptidyl peptidase 4 OS=Rattus norvegicus GN=Dpp4 PE=1 SV=2 3 149 3.0E-28
sp|P22411|DPP4_PIG Dipeptidyl peptidase 4 OS=Sus scrofa GN=DPP4 PE=1 SV=3 3 149 3.0E-28
sp|P81425|DPP4_BOVIN Dipeptidyl peptidase 4 OS=Bos taurus GN=DPP4 PE=1 SV=3 3 149 3.0E-28
sp|P28843|DPP4_MOUSE Dipeptidyl peptidase 4 OS=Mus musculus GN=Dpp4 PE=1 SV=3 3 149 8.0E-28
sp|A0S5V9|DPP4_ARTOT Dipeptidyl peptidase 4 OS=Arthroderma otae GN=DPP4 PE=3 SV=1 5 140 2.0E-27
sp|C5FJE3|DPP4_ARTOC Dipeptidyl peptidase 4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=DPP4 PE=3 SV=2 5 140 2.0E-27
sp|P27487|DPP4_HUMAN Dipeptidyl peptidase 4 OS=Homo sapiens GN=DPP4 PE=1 SV=2 3 149 3.0E-27
sp|Q9N2I7|DPP4_FELCA Dipeptidyl peptidase 4 OS=Felis catus GN=DPP4 PE=2 SV=1 3 149 5.0E-27
sp|D4APE2|DPP4_ARTBC Probable dipeptidyl peptidase 4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=DPP4 PE=1 SV=1 5 171 1.0E-26
sp|B1A4F7|VDDP4_VESVU Venom dipeptidyl peptidase 4 OS=Vespula vulgaris PE=1 SV=1 1 127 2.0E-26
sp|B6V868|DPP4_TRITO Dipeptidyl peptidase 4 OS=Trichophyton tonsurans GN=DPP4 PE=3 SV=1 5 171 3.0E-26
sp|A7UKV8|DPP4_TRIEQ Dipeptidyl peptidase 4 OS=Trichophyton equinum GN=DPP4 PE=3 SV=1 5 171 3.0E-26
sp|B2D0J4|VDPP4_APIME Venom dipeptidyl peptidase 4 OS=Apis mellifera PE=1 SV=1 3 127 5.0E-25
sp|Q5J6J3|DPP4_TRIRU Dipeptidyl peptidase 4 OS=Trichophyton rubrum GN=DPP4 PE=1 SV=1 5 171 6.0E-25
sp|P97321|SEPR_MOUSE Prolyl endopeptidase FAP OS=Mus musculus GN=Fap PE=1 SV=1 3 149 2.0E-24
sp|Q12884|SEPR_HUMAN Prolyl endopeptidase FAP OS=Homo sapiens GN=FAP PE=1 SV=5 3 149 3.0E-24
sp|A5D7B7|SEPR_BOVIN Prolyl endopeptidase FAP OS=Bos taurus GN=FAP PE=1 SV=1 3 128 9.0E-24
sp|Q6F3I7|DAP4_PSEMX Dipeptidyl aminopeptidase 4 OS=Pseudoxanthomonas mexicana GN=dap4 PE=1 SV=1 3 127 1.0E-23
sp|Q18253|DPF2_CAEEL Dipeptidyl peptidase family member 2 OS=Caenorhabditis elegans GN=dpf-2 PE=1 SV=1 3 146 2.0E-23
sp|Q8N608|DPP10_HUMAN Inactive dipeptidyl peptidase 10 OS=Homo sapiens GN=DPP10 PE=1 SV=2 1 128 4.0E-23
sp|Q7JKY3|DPF1_CAEEL Dipeptidyl peptidase family member 1 OS=Caenorhabditis elegans GN=dpf-1 PE=1 SV=1 4 128 2.0E-22
sp|Q9P7E9|YDZF_SCHPO Putative dipeptidyl aminopeptidase C14C4.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC14C4.15c PE=3 SV=2 2 128 2.0E-22
sp|Q6V1X1|DPP8_HUMAN Dipeptidyl peptidase 8 OS=Homo sapiens GN=DPP8 PE=1 SV=1 3 127 2.0E-21
sp|Q8BVG4|DPP9_MOUSE Dipeptidyl peptidase 9 OS=Mus musculus GN=Dpp9 PE=1 SV=2 3 127 2.0E-21
sp|Q6NXK7|DPP10_MOUSE Inactive dipeptidyl peptidase 10 OS=Mus musculus GN=Dpp10 PE=1 SV=1 2 128 2.0E-21
sp|Q6Q629|DPP10_RAT Inactive dipeptidyl peptidase 10 OS=Rattus norvegicus GN=Dpp10 PE=1 SV=1 2 128 2.0E-21
sp|Q80YA7|DPP8_MOUSE Dipeptidyl peptidase 8 OS=Mus musculus GN=Dpp8 PE=1 SV=1 3 127 4.0E-21
sp|Q86TI2|DPP9_HUMAN Dipeptidyl peptidase 9 OS=Homo sapiens GN=DPP9 PE=1 SV=3 3 127 5.0E-21
sp|Q5IS50|DPP6_PANTR Dipeptidyl aminopeptidase-like protein 6 OS=Pan troglodytes GN=DPP6 PE=2 SV=1 3 148 2.0E-20
sp|P42658|DPP6_HUMAN Dipeptidyl aminopeptidase-like protein 6 OS=Homo sapiens GN=DPP6 PE=1 SV=2 3 148 4.0E-20
sp|D4CZ59|DPP4_TRIVH Probable dipeptidyl peptidase 4 OS=Trichophyton verrucosum (strain HKI 0517) GN=DPP4 PE=3 SV=1 5 171 1.0E-19
sp|Q9Z218|DPP6_MOUSE Dipeptidyl aminopeptidase-like protein 6 OS=Mus musculus GN=Dpp6 PE=1 SV=1 3 131 1.0E-18
sp|P46101|DPP6_RAT Dipeptidyl aminopeptidase-like protein 6 OS=Rattus norvegicus GN=Dpp6 PE=1 SV=1 3 131 2.0E-18
sp|P42659|DPP6_BOVIN Dipeptidyl aminopeptidase-like protein 6 OS=Bos taurus GN=DPP6 PE=1 SV=1 2 128 3.0E-18
sp|Q7MUW6|PTP_PORGI Prolyl tripeptidyl peptidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=ptpA PE=1 SV=1 3 127 3.0E-15
sp|B2RJX3|PTP_PORG3 Prolyl tripeptidyl peptidase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=ptpA PE=3 SV=1 3 127 3.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.3433 0.132 0.6061 0.4588 0.3191 0.1502 0.3777 0.3128 0.4938 0.0796

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup269
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2374
Ophiocordyceps australis 1348a (Ghana) OphauG2|3464
Ophiocordyceps australis map64 (Brazil) OphauB2|2227
Ophiocordyceps australis map64 (Brazil) OphauB2|6049
Ophiocordyceps camponoti-floridani Ophcf2|06395
Ophiocordyceps camponoti-rufipedis Ophun1|3478
Ophiocordyceps kimflemingae Ophio5|4873
Ophiocordyceps subramaniannii Hirsu2|132 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5847
Ophiocordyceps subramaniannii Hirsu2|9025

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|132
LPYVDPARLAIWGWSYGGFAALKTLEQDAGATFGYGMAVAPVTDWRFYDSVYTERYMRLPADNAAGYAASRVANA
SALGAATRFLLVHGAADDNVHLQNSLHLLDDLDRAGVRNYDVHLFPDSDHSISFHNANRIVYYKLRDWLVNAFNG
EWLKTKDPEPIGRLRARFVAARRALWPRP*
Coding >Hirsu2|132
CTGCCCTACGTCGACCCGGCCCGGCTCGCCATCTGGGGCTGGTCGTACGGCGGCTTCGCCGCGCTCAAGACGCTC
GAGCAGGACGCCGGCGCCACCTTCGGCTACGGCATGGCCGTCGCCCCCGTCACCGACTGGCGCTTCTACGACTCC
GTCTACACGGAGCGCTACATGCGCCTGCCCGCCGACAACGCCGCCGGCTACGCCGCCTCGCGCGTCGCCAACGCC
TCCGCCCTCGGCGCCGCCACCCGCTTCCTGCTCGTCCACGGCGCCGCCGACGACAACGTCCACCTGCAGAACTCG
CTGCACCTGCTCGACGACCTCGACCGCGCCGGCGTCCGCAACTACGACGTCCACCTCTTCCCGGACTCGGACCAC
AGCATCTCCTTCCACAACGCCAACCGCATCGTCTACTACAAACTGCGCGACTGGCTCGTCAACGCCTTCAATGGC
GAGTGGCTCAAGACCAAGGACCCCGAGCCCATCGGCCGGCTGCGTGCTCGCTTCGTCGCCGCCCGCCGCGCCCTG
TGGCCGCGCCCGTGA
Transcript >Hirsu2|132
CTGCCCTACGTCGACCCGGCCCGGCTCGCCATCTGGGGCTGGTCGTACGGCGGCTTCGCCGCGCTCAAGACGCTC
GAGCAGGACGCCGGCGCCACCTTCGGCTACGGCATGGCCGTCGCCCCCGTCACCGACTGGCGCTTCTACGACTCC
GTCTACACGGAGCGCTACATGCGCCTGCCCGCCGACAACGCCGCCGGCTACGCCGCCTCGCGCGTCGCCAACGCC
TCCGCCCTCGGCGCCGCCACCCGCTTCCTGCTCGTCCACGGCGCCGCCGACGACAACGTCCACCTGCAGAACTCG
CTGCACCTGCTCGACGACCTCGACCGCGCCGGCGTCCGCAACTACGACGTCCACCTCTTCCCGGACTCGGACCAC
AGCATCTCCTTCCACAACGCCAACCGCATCGTCTACTACAAACTGCGCGACTGGCTCGTCAACGCCTTCAATGGC
GAGTGGCTCAAGACCAAGGACCCCGAGCCCATCGGCCGGCTGCGTGCTCGCTTCGTCGCCGCCCGCCGCGCCCTG
TGGCCGCGCCCGTGA
Gene >Hirsu2|132
CTGCCCTACGTCGACCCGGCCCGGCTCGCCATCTGGGGCTGGTCGTACGGCGGCTTCGCCGCGCTCAAGACGCTC
GAGCAGGACGCCGGCGCCACCTTCGGCTACGGCATGGCCGTCGCCCCCGTCACCGACTGGCGCTTCTACGACTCC
GTCTACACGGAGCGCTACATGCGCCTGCCCGCCGACAACGCCGCCGGCTACGCCGCCTCGCGCGTCGCCAACGCC
TCCGCCCTCGGCGCCGCCACCCGCTTCCTGCTCGTCCACGGCGCCGCCGACGACAACGTCCACCTGCAGAACTCG
CTGCACCTGCTCGACGACCTCGACCGCGCCGGCGTCCGCAACTACGACGTCCACCTCTTCCCGGACTCGGACCAC
AGCATCTCCTTCCACAACGCCAACCGCATCGTCTACTACAGTGAGCTCTCCTTCTTCCCTTTTCGCTCTCCCTCT
CTTCTCTTCTTTTTTGCTCTTCGCCTTCTTCATCTTTCCCCCGCCGCTGATTCGTCCCCCCGTCGCAGAACTGCG
CGACTGGCTCGTCAACGCCTTCAATGGCGAGTGGCTCAAGACCAAGGACCCCGAGCCCATCGGCCGGCTGCGTGC
TCGCTTCGTCGCCGCCCGCCGCGCCCTGTGGCCGCGCCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail