Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1308
Gene name
LocationContig_1288:1686..7331
Strand+
Gene length (bp)5645
Transcript length (bp)5367
Coding sequence length (bp)5367
Protein length (aa) 1789

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16507 BLM10_mid Proteasome-substrate-size regulator, mid region 1.1E-197 385 912
PF16547 BLM10_N Proteasome-substrate-size regulator, N-terminal 1.7E-19 34 99

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43583|BLM10_YEAST Proteasome activator BLM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BLM10 PE=1 SV=2 102 1751 4.0E-68
sp|Q5SSW2|PSME4_MOUSE Proteasome activator complex subunit 4 OS=Mus musculus GN=Psme4 PE=1 SV=1 57 884 4.0E-59
sp|F1MKX4|PSME4_BOVIN Proteasome activator complex subunit 4 OS=Bos taurus GN=PSME4 PE=1 SV=1 32 878 1.0E-57
sp|F1R2X6|PSM4B_DANRE Proteasome activator complex subunit 4B OS=Danio rerio GN=psme4b PE=3 SV=2 58 914 1.0E-57
sp|Q6NRP2|PSME4_XENLA Proteasome activator complex subunit 4 OS=Xenopus laevis GN=psme4 PE=2 SV=1 58 914 3.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43583|BLM10_YEAST Proteasome activator BLM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BLM10 PE=1 SV=2 102 1751 4.0E-68
sp|Q5SSW2|PSME4_MOUSE Proteasome activator complex subunit 4 OS=Mus musculus GN=Psme4 PE=1 SV=1 57 884 4.0E-59
sp|F1MKX4|PSME4_BOVIN Proteasome activator complex subunit 4 OS=Bos taurus GN=PSME4 PE=1 SV=1 32 878 1.0E-57
sp|F1R2X6|PSM4B_DANRE Proteasome activator complex subunit 4B OS=Danio rerio GN=psme4b PE=3 SV=2 58 914 1.0E-57
sp|Q6NRP2|PSME4_XENLA Proteasome activator complex subunit 4 OS=Xenopus laevis GN=psme4 PE=2 SV=1 58 914 3.0E-57
sp|Q14997|PSME4_HUMAN Proteasome activator complex subunit 4 OS=Homo sapiens GN=PSME4 PE=1 SV=2 58 872 9.0E-57
sp|F1QFR9|PSM4A_DANRE Proteasome activator complex subunit 4A OS=Danio rerio GN=psme4a PE=3 SV=2 58 856 6.0E-56
sp|F4JC97|PSME4_ARATH Proteasome activator subunit 4 OS=Arabidopsis thaliana GN=PA200 PE=2 SV=2 69 871 8.0E-26
sp|F1R2X6|PSM4B_DANRE Proteasome activator complex subunit 4B OS=Danio rerio GN=psme4b PE=3 SV=2 1011 1646 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1308
MDENMGLRREGSHAGLAPSAASHLTTSFALYEPVSRATSPGTPYAKTDEDDKKRYRPRTFAYFQQLPFEVEKEAQ
RDAALHGILKQLYTAVRAEDFSPGALHWTRELQAWLNLKFEMTRELRARLAKLFYSLALAPGLDHTAADRFLRMV
LTLTRKNHYLKPVDDLTLDWRPLWAEIKAWVLPSEGPAHQSSRRRGAKQLLKLCQYAHAFFDPRDRPAILEELLP
YFGVNELPNAFIVIGALNALLPSHPAPADEPLAQPQHFLPTLFHLWSIVNRSKVVDMFFMDLLSRLTRDHIQCGH
VPFSEYGIFTREQSDLVFTAMLRLTQIPVGQANSPYTPVDYLSGAGGYLEKDKKKYPVAYVMARLVTSCLSPKCM
DQRESIMSSLEGLIESIDTFFHPSNQGAWTTMLGQFVLYLTDSFVSRWNRERSGELDIPPDRNITPALKRRFVLS
LREVTFMGLFSKSARVSHCYYNALQGLAYLEPDLVLPGALQRFYPSLQGLVEVHRTTSSLNGLQMIASIMCRLKG
YRCHVTALLALALPGIDANDLNKTQYTLNFIQSVAYSVPFVPMTSDASHIHDTTLAMQWVQAEMDRMERDGQNVQ
IDYQSELSDEDETNILRSSTAGFGEFVLTLLGKIFTLLENLPDANQVRGGTPEDNVINALPAALSPLFASLSPDI
FDMALDKIATFVSSHVVHQARDAMAWILNALCKVSPEKTLKVFVPMLVVNIRNEIDYNNAASDRTTGTDYLPRDR
ALVWHVSMLAMAVVHVGSEVLRYRDELLGVAEYMQDKCRGLPTILVSNYIHHLLLNLTHTYPIDHALFEPDVMRR
GLDIGDWGKTTAAADLTIRWHQPSPAEIEFAVELFASQVTSAVRQLELLMSDDPPVSREGKNKAWSDEVSRLMQQ
IRLVIAGMATMFDPKRASGGGQRNGEAGQGAAAAADAPGDGDEAMMMMMMDDGDGDVGGGGGGGGDDDDDDDDDA
LAEDADDEELRPQFRYKAGYLLKPGDAAYERIHELRDELGHLLTKAHAFLAEKQEDDVNCFTALCSAYRTWITDV
GIERSAHPLERHLRLYKADIAAFKIKGLRKVYPRPLLIKRAEAYHILRMKHNASARHKSELDRRLLLDLAQLCLS
LYADVRRVAQSAQDSSLKALIGGKPVVIPVILDGLGAAIRTNEHDRIKGGMYTLLFTSLLRTVLRDWRFAPEAMR
LYIETAGIDKPSIQNLGSTALYSMFEFGKPLERAILVDDAVVDSIRPQADVSAAVEKRHAFIVQRRGRVESAKAA
LGLELTRRARGAHWKIATRCAIFATNLCLRFDDVAPSEFVELVARGTNDPHPSLRGYYLNAFTSLFTMIDMRAVY
GHDYTNYLLERETGDRNRLEVPVAKGDAAFTERFLEAFRQQPEGAEYLVDFDHPGWLVWGSKFTAYRARPLPFDA
YDEVETAVREQVGGILTRDWVARCFEYFKQEPRDQSTDRFRMSYVYLLMHVFDLMHYGKTAVTLGDVEELTRAVY
GDGSDKHQHRATSEILGALLAGSSDDPLEIRDRVWRFAAPMMLQIVADDLTPENLQYWLTCLHFVLDAKDPRRSH
EIVDRLKSIRLDMTSNAAFKESSKVQLVEFVVADGGWHFRDAKPILDHFAAHIDHPYKAVREAIGRLLSAIEKSR
YYECFESVPKLLEDNKRASSIGIRPYRPSAELAATVADVFGRLERWRLERTPGQQTPSSYTSGSKTVLMWLDCTL
SSHECIELVPFFAEPFMEQLLHMMDVKEDPELMNGAYHVYRHLPNIPFRSGEDVESSTSGASS*
Coding >Hirsu2|1308
ATGGACGAGAACATGGGCCTGCGGCGCGAGGGCTCCCACGCCGGGCTGGCGCCGTCGGCCGCCTCGCACCTGACG
ACGAGCTTCGCCCTGTACGAGCCCGTCTCGCGCGCCACGTCGCCCGGCACGCCCTACGCCAAGACGGACGAGGAC
GACAAGAAGCGCTACCGCCCCCGGACCTTTGCCTACTTCCAGCAGCTGCCCTTCGAGGTCGAGAAGGAGGCCCAG
CGCGACGCCGCCCTGCACGGCATCCTCAAGCAGCTCTACACCGCCGTCCGCGCCGAGGACTTCTCCCCGGGCGCC
CTGCACTGGACCCGCGAGCTGCAGGCCTGGCTCAACCTCAAGTTCGAGATGACGCGCGAGCTGCGCGCCCGCCTG
GCCAAGCTCTTTTACTCCCTCGCCCTGGCCCCGGGCTTGGATCACACTGCCGCCGACCGCTTCCTGCGCATGGTC
TTGACCCTCACCAGGAAGAACCACTACCTCAAGCCCGTCGATGACCTCACCCTCGACTGGAGGCCGCTGTGGGCC
GAGATCAAGGCCTGGGTCCTGCCGTCCGAGGGCCCCGCCCACCAGAGCAGCCGCCGCCGGGGGGCCAAGCAGCTC
CTCAAGCTCTGCCAGTACGCCCACGCCTTCTTCGACCCCCGCGACCGGCCGGCCATACTCGAGGAGCTGCTGCCG
TACTTCGGCGTCAACGAGCTGCCCAACGCCTTCATCGTCATCGGTGCCCTCAACGCCCTGCTGCCCAGCCATCCC
GCCCCCGCCGACGAGCCGCTGGCCCAGCCGCAGCACTTCCTGCCCACCCTCTTCCACCTGTGGTCCATCGTCAAC
CGCTCCAAGGTCGTCGACATGTTCTTCATGGACCTCTTGTCCCGCCTGACCCGCGACCACATCCAGTGCGGCCAC
GTGCCCTTCTCCGAGTACGGCATCTTCACCCGCGAGCAGTCGGACCTCGTCTTCACCGCCATGCTGCGCCTGACC
CAGATCCCCGTCGGCCAGGCCAACTCGCCCTACACCCCCGTCGACTACCTGTCCGGCGCCGGCGGCTACCTCGAG
AAGGACAAGAAGAAGTACCCGGTCGCCTACGTCATGGCCCGCCTCGTCACCAGCTGCCTCTCCCCCAAGTGCATG
GACCAGCGCGAGTCCATCATGTCCAGCCTCGAGGGCCTCATCGAGTCCATCGACACCTTCTTCCACCCCTCCAAC
CAGGGCGCCTGGACCACCATGCTCGGCCAGTTCGTCCTCTACCTGACCGACAGCTTCGTCTCGCGCTGGAACCGG
GAGCGGAGCGGCGAGCTCGACATACCCCCGGACCGCAACATCACCCCCGCCCTCAAGCGCCGCTTCGTCCTCTCC
CTCCGCGAGGTCACCTTCATGGGCCTCTTCTCCAAGAGCGCGCGCGTCTCCCACTGCTACTACAACGCCCTGCAG
GGCCTGGCCTACCTCGAGCCGGACCTGGTGCTGCCCGGCGCCCTGCAGCGCTTCTACCCCAGCCTGCAGGGGCTC
GTCGAGGTCCACCGCACGACGTCGAGCCTCAACGGCCTGCAGATGATCGCCAGCATCATGTGCCGCCTCAAGGGC
TACCGCTGCCACGTCACGGCCCTCCTGGCCCTCGCCCTGCCGGGCATCGACGCCAACGACCTCAACAAGACGCAG
TACACGCTCAACTTCATCCAGAGCGTCGCCTACAGCGTCCCCTTCGTGCCCATGACGAGCGACGCCAGCCACATC
CACGACACCACCCTCGCCATGCAGTGGGTCCAGGCCGAGATGGACCGCATGGAGCGCGACGGCCAGAACGTCCAG
ATCGACTACCAGTCCGAGCTCAGCGACGAGGACGAGACCAACATCCTGCGCTCCTCCACCGCCGGCTTCGGCGAG
TTCGTCCTGACGCTCCTCGGCAAGATCTTCACGCTGCTGGAGAACCTGCCGGACGCGAACCAGGTCCGCGGCGGC
ACGCCCGAGGACAACGTCATCAACGCCCTGCCCGCCGCCCTCTCGCCCCTCTTCGCCTCGCTCTCCCCCGACATC
TTCGACATGGCGCTCGACAAGATCGCGACCTTCGTCTCGAGCCACGTCGTGCACCAGGCGCGCGACGCCATGGCC
TGGATCCTCAACGCCCTCTGCAAGGTCAGCCCGGAGAAGACGCTCAAGGTCTTCGTGCCCATGCTCGTCGTCAAC
ATCCGCAACGAGATCGACTACAACAACGCGGCCTCGGACCGCACCACCGGCACCGACTACCTGCCGCGCGACCGC
GCCCTCGTCTGGCACGTGAGCATGCTCGCCATGGCCGTCGTCCACGTCGGCAGCGAGGTGCTCCGCTACCGCGAC
GAGCTGCTCGGCGTCGCCGAGTACATGCAGGACAAGTGCCGCGGCCTGCCCACCATCCTCGTCTCCAACTACATC
CACCACCTGCTGCTCAACCTGACGCACACCTACCCCATCGACCACGCCCTCTTCGAGCCCGACGTCATGCGGAGG
GGGCTCGACATCGGCGACTGGGGCAAGACGACGGCCGCCGCCGACCTCACCATCCGCTGGCACCAGCCGTCGCCC
GCCGAGATCGAGTTCGCCGTCGAGCTGTTCGCCTCGCAGGTCACGTCGGCCGTCCGGCAGCTGGAGCTGCTCATG
AGCGACGACCCCCCCGTCAGCAGGGAGGGCAAGAACAAGGCCTGGTCGGACGAGGTGTCGAGGCTCATGCAGCAG
ATCCGCCTGGTCATCGCCGGCATGGCCACCATGTTCGACCCGAAGCGCGCGTCTGGCGGCGGCCAAAGAAACGGC
GAAGCTGGCCAAGGCGCCGCCGCCGCCGCCGACGCCCCGGGAGACGGTGACGAGGCGATGATGATGATGATGATG
GACGACGGCGACGGCGACGTTGGCGGCGGCGGCGGCGGCGGCGGCGACGACGACGACGACGACGACGACGACGCG
CTGGCCGAAGACGCCGACGACGAGGAGCTGCGGCCCCAGTTCCGCTACAAGGCCGGGTACCTGCTGAAGCCCGGC
GACGCGGCGTACGAGCGGATCCACGAGCTGCGCGACGAGCTGGGCCACCTCCTGACCAAGGCGCACGCCTTCCTG
GCCGAGAAGCAGGAGGACGACGTCAACTGCTTCACCGCCCTGTGCTCGGCCTACCGCACCTGGATCACGGACGTG
GGCATCGAGAGGTCCGCCCACCCGCTCGAGAGGCACCTCCGGCTGTACAAGGCGGACATCGCGGCCTTCAAGATC
AAGGGCCTGCGCAAGGTGTACCCGCGCCCGCTGCTGATCAAGCGCGCCGAGGCGTACCACATCCTGCGCATGAAG
CACAACGCGTCGGCCCGGCACAAGAGCGAGCTGGACAGGCGGCTCCTGCTCGACCTCGCGCAGCTGTGCCTGTCG
CTGTACGCCGACGTCCGCCGGGTGGCGCAGAGCGCGCAGGACTCGTCGCTCAAGGCCCTCATCGGCGGCAAGCCC
GTCGTGATACCCGTCATCCTCGACGGCCTCGGCGCCGCCATCCGGACCAACGAGCACGACCGGATCAAGGGCGGC
ATGTACACCCTGCTCTTCACCTCGCTGCTGCGGACCGTGCTCCGGGACTGGCGCTTCGCGCCCGAGGCGATGCGG
CTGTACATCGAGACGGCGGGCATCGACAAGCCGTCCATCCAGAACCTGGGCTCCACCGCCCTCTACTCCATGTTC
GAGTTCGGCAAGCCGCTCGAGCGCGCCATCCTGGTCGACGACGCCGTCGTCGACAGCATCCGGCCCCAGGCCGAC
GTCTCGGCCGCCGTCGAGAAGCGGCACGCCTTCATCGTGCAGCGGCGCGGCCGGGTCGAGAGCGCCAAGGCGGCG
CTGGGCCTGGAGCTGACGCGGCGGGCGAGGGGCGCCCACTGGAAGATCGCGACGCGGTGCGCCATCTTCGCCACC
AACCTGTGCCTGCGCTTCGACGACGTGGCGCCGTCCGAGTTCGTCGAGCTGGTCGCGCGCGGCACCAACGACCCG
CACCCGAGCCTGAGAGGCTACTACCTCAACGCCTTCACCTCGCTCTTCACCATGATCGACATGCGGGCCGTCTAC
GGCCACGACTACACCAACTACCTGCTCGAGCGCGAGACGGGCGACCGGAACCGGCTCGAGGTACCGGTGGCCAAG
GGCGACGCCGCCTTCACCGAGCGCTTCCTCGAGGCCTTCCGGCAGCAGCCCGAGGGCGCCGAGTACCTGGTCGAC
TTCGACCACCCGGGCTGGCTCGTCTGGGGCAGCAAGTTCACGGCGTACCGGGCGCGGCCGCTGCCGTTCGACGCC
TACGACGAGGTCGAGACGGCGGTGCGGGAGCAGGTGGGCGGGATCCTGACGCGCGACTGGGTCGCGCGCTGCTTC
GAGTACTTCAAGCAGGAGCCGCGGGACCAGTCGACGGACCGGTTCCGGATGAGCTACGTCTACCTGCTCATGCAC
GTCTTCGACCTGATGCACTACGGCAAGACGGCCGTGACGCTCGGCGACGTCGAGGAGCTGACGCGCGCCGTGTAC
GGCGACGGGAGCGACAAGCACCAGCACCGGGCGACGTCGGAGATCCTGGGGGCGCTGCTGGCGGGCTCGAGCGAC
GACCCGCTCGAGATCCGCGACCGCGTCTGGCGCTTCGCGGCGCCCATGATGCTGCAGATCGTCGCCGACGACCTG
ACGCCGGAGAACCTGCAGTACTGGCTGACGTGCCTGCACTTCGTGCTCGACGCCAAGGACCCGCGGCGGTCGCAC
GAGATCGTGGACCGGCTCAAGTCGATCCGGCTCGACATGACGTCCAACGCGGCCTTCAAGGAGTCGTCCAAGGTG
CAGCTGGTCGAGTTCGTGGTGGCGGACGGCGGCTGGCACTTCCGCGACGCCAAGCCGATCCTCGACCACTTCGCC
GCGCACATCGACCACCCGTACAAGGCGGTGCGCGAGGCCATCGGCCGGCTGCTGTCGGCCATCGAGAAGTCGCGC
TACTACGAGTGCTTCGAGAGCGTGCCCAAGCTGCTCGAGGACAACAAGCGGGCGTCGTCGATCGGGATCCGGCCC
TACCGGCCGTCGGCGGAGCTGGCGGCGACGGTCGCCGACGTCTTCGGCCGGCTCGAGAGGTGGCGGCTGGAGCGG
ACGCCGGGCCAGCAGACGCCGTCGTCGTACACGTCCGGGTCCAAGACGGTGCTCATGTGGCTCGACTGCACCCTG
TCGTCGCACGAGTGCATCGAGCTGGTGCCCTTCTTCGCCGAGCCCTTCATGGAGCAGCTGCTGCACATGATGGAC
GTCAAGGAGGACCCGGAGCTGATGAACGGCGCCTACCACGTGTACCGGCACCTGCCCAACATACCCTTCCGCAGC
GGCGAGGACGTCGAGTCGTCTACTTCCGGCGCATCTTCCTGA
Transcript >Hirsu2|1308
ATGGACGAGAACATGGGCCTGCGGCGCGAGGGCTCCCACGCCGGGCTGGCGCCGTCGGCCGCCTCGCACCTGACG
ACGAGCTTCGCCCTGTACGAGCCCGTCTCGCGCGCCACGTCGCCCGGCACGCCCTACGCCAAGACGGACGAGGAC
GACAAGAAGCGCTACCGCCCCCGGACCTTTGCCTACTTCCAGCAGCTGCCCTTCGAGGTCGAGAAGGAGGCCCAG
CGCGACGCCGCCCTGCACGGCATCCTCAAGCAGCTCTACACCGCCGTCCGCGCCGAGGACTTCTCCCCGGGCGCC
CTGCACTGGACCCGCGAGCTGCAGGCCTGGCTCAACCTCAAGTTCGAGATGACGCGCGAGCTGCGCGCCCGCCTG
GCCAAGCTCTTTTACTCCCTCGCCCTGGCCCCGGGCTTGGATCACACTGCCGCCGACCGCTTCCTGCGCATGGTC
TTGACCCTCACCAGGAAGAACCACTACCTCAAGCCCGTCGATGACCTCACCCTCGACTGGAGGCCGCTGTGGGCC
GAGATCAAGGCCTGGGTCCTGCCGTCCGAGGGCCCCGCCCACCAGAGCAGCCGCCGCCGGGGGGCCAAGCAGCTC
CTCAAGCTCTGCCAGTACGCCCACGCCTTCTTCGACCCCCGCGACCGGCCGGCCATACTCGAGGAGCTGCTGCCG
TACTTCGGCGTCAACGAGCTGCCCAACGCCTTCATCGTCATCGGTGCCCTCAACGCCCTGCTGCCCAGCCATCCC
GCCCCCGCCGACGAGCCGCTGGCCCAGCCGCAGCACTTCCTGCCCACCCTCTTCCACCTGTGGTCCATCGTCAAC
CGCTCCAAGGTCGTCGACATGTTCTTCATGGACCTCTTGTCCCGCCTGACCCGCGACCACATCCAGTGCGGCCAC
GTGCCCTTCTCCGAGTACGGCATCTTCACCCGCGAGCAGTCGGACCTCGTCTTCACCGCCATGCTGCGCCTGACC
CAGATCCCCGTCGGCCAGGCCAACTCGCCCTACACCCCCGTCGACTACCTGTCCGGCGCCGGCGGCTACCTCGAG
AAGGACAAGAAGAAGTACCCGGTCGCCTACGTCATGGCCCGCCTCGTCACCAGCTGCCTCTCCCCCAAGTGCATG
GACCAGCGCGAGTCCATCATGTCCAGCCTCGAGGGCCTCATCGAGTCCATCGACACCTTCTTCCACCCCTCCAAC
CAGGGCGCCTGGACCACCATGCTCGGCCAGTTCGTCCTCTACCTGACCGACAGCTTCGTCTCGCGCTGGAACCGG
GAGCGGAGCGGCGAGCTCGACATACCCCCGGACCGCAACATCACCCCCGCCCTCAAGCGCCGCTTCGTCCTCTCC
CTCCGCGAGGTCACCTTCATGGGCCTCTTCTCCAAGAGCGCGCGCGTCTCCCACTGCTACTACAACGCCCTGCAG
GGCCTGGCCTACCTCGAGCCGGACCTGGTGCTGCCCGGCGCCCTGCAGCGCTTCTACCCCAGCCTGCAGGGGCTC
GTCGAGGTCCACCGCACGACGTCGAGCCTCAACGGCCTGCAGATGATCGCCAGCATCATGTGCCGCCTCAAGGGC
TACCGCTGCCACGTCACGGCCCTCCTGGCCCTCGCCCTGCCGGGCATCGACGCCAACGACCTCAACAAGACGCAG
TACACGCTCAACTTCATCCAGAGCGTCGCCTACAGCGTCCCCTTCGTGCCCATGACGAGCGACGCCAGCCACATC
CACGACACCACCCTCGCCATGCAGTGGGTCCAGGCCGAGATGGACCGCATGGAGCGCGACGGCCAGAACGTCCAG
ATCGACTACCAGTCCGAGCTCAGCGACGAGGACGAGACCAACATCCTGCGCTCCTCCACCGCCGGCTTCGGCGAG
TTCGTCCTGACGCTCCTCGGCAAGATCTTCACGCTGCTGGAGAACCTGCCGGACGCGAACCAGGTCCGCGGCGGC
ACGCCCGAGGACAACGTCATCAACGCCCTGCCCGCCGCCCTCTCGCCCCTCTTCGCCTCGCTCTCCCCCGACATC
TTCGACATGGCGCTCGACAAGATCGCGACCTTCGTCTCGAGCCACGTCGTGCACCAGGCGCGCGACGCCATGGCC
TGGATCCTCAACGCCCTCTGCAAGGTCAGCCCGGAGAAGACGCTCAAGGTCTTCGTGCCCATGCTCGTCGTCAAC
ATCCGCAACGAGATCGACTACAACAACGCGGCCTCGGACCGCACCACCGGCACCGACTACCTGCCGCGCGACCGC
GCCCTCGTCTGGCACGTGAGCATGCTCGCCATGGCCGTCGTCCACGTCGGCAGCGAGGTGCTCCGCTACCGCGAC
GAGCTGCTCGGCGTCGCCGAGTACATGCAGGACAAGTGCCGCGGCCTGCCCACCATCCTCGTCTCCAACTACATC
CACCACCTGCTGCTCAACCTGACGCACACCTACCCCATCGACCACGCCCTCTTCGAGCCCGACGTCATGCGGAGG
GGGCTCGACATCGGCGACTGGGGCAAGACGACGGCCGCCGCCGACCTCACCATCCGCTGGCACCAGCCGTCGCCC
GCCGAGATCGAGTTCGCCGTCGAGCTGTTCGCCTCGCAGGTCACGTCGGCCGTCCGGCAGCTGGAGCTGCTCATG
AGCGACGACCCCCCCGTCAGCAGGGAGGGCAAGAACAAGGCCTGGTCGGACGAGGTGTCGAGGCTCATGCAGCAG
ATCCGCCTGGTCATCGCCGGCATGGCCACCATGTTCGACCCGAAGCGCGCGTCTGGCGGCGGCCAAAGAAACGGC
GAAGCTGGCCAAGGCGCCGCCGCCGCCGCCGACGCCCCGGGAGACGGTGACGAGGCGATGATGATGATGATGATG
GACGACGGCGACGGCGACGTTGGCGGCGGCGGCGGCGGCGGCGGCGACGACGACGACGACGACGACGACGACGCG
CTGGCCGAAGACGCCGACGACGAGGAGCTGCGGCCCCAGTTCCGCTACAAGGCCGGGTACCTGCTGAAGCCCGGC
GACGCGGCGTACGAGCGGATCCACGAGCTGCGCGACGAGCTGGGCCACCTCCTGACCAAGGCGCACGCCTTCCTG
GCCGAGAAGCAGGAGGACGACGTCAACTGCTTCACCGCCCTGTGCTCGGCCTACCGCACCTGGATCACGGACGTG
GGCATCGAGAGGTCCGCCCACCCGCTCGAGAGGCACCTCCGGCTGTACAAGGCGGACATCGCGGCCTTCAAGATC
AAGGGCCTGCGCAAGGTGTACCCGCGCCCGCTGCTGATCAAGCGCGCCGAGGCGTACCACATCCTGCGCATGAAG
CACAACGCGTCGGCCCGGCACAAGAGCGAGCTGGACAGGCGGCTCCTGCTCGACCTCGCGCAGCTGTGCCTGTCG
CTGTACGCCGACGTCCGCCGGGTGGCGCAGAGCGCGCAGGACTCGTCGCTCAAGGCCCTCATCGGCGGCAAGCCC
GTCGTGATACCCGTCATCCTCGACGGCCTCGGCGCCGCCATCCGGACCAACGAGCACGACCGGATCAAGGGCGGC
ATGTACACCCTGCTCTTCACCTCGCTGCTGCGGACCGTGCTCCGGGACTGGCGCTTCGCGCCCGAGGCGATGCGG
CTGTACATCGAGACGGCGGGCATCGACAAGCCGTCCATCCAGAACCTGGGCTCCACCGCCCTCTACTCCATGTTC
GAGTTCGGCAAGCCGCTCGAGCGCGCCATCCTGGTCGACGACGCCGTCGTCGACAGCATCCGGCCCCAGGCCGAC
GTCTCGGCCGCCGTCGAGAAGCGGCACGCCTTCATCGTGCAGCGGCGCGGCCGGGTCGAGAGCGCCAAGGCGGCG
CTGGGCCTGGAGCTGACGCGGCGGGCGAGGGGCGCCCACTGGAAGATCGCGACGCGGTGCGCCATCTTCGCCACC
AACCTGTGCCTGCGCTTCGACGACGTGGCGCCGTCCGAGTTCGTCGAGCTGGTCGCGCGCGGCACCAACGACCCG
CACCCGAGCCTGAGAGGCTACTACCTCAACGCCTTCACCTCGCTCTTCACCATGATCGACATGCGGGCCGTCTAC
GGCCACGACTACACCAACTACCTGCTCGAGCGCGAGACGGGCGACCGGAACCGGCTCGAGGTACCGGTGGCCAAG
GGCGACGCCGCCTTCACCGAGCGCTTCCTCGAGGCCTTCCGGCAGCAGCCCGAGGGCGCCGAGTACCTGGTCGAC
TTCGACCACCCGGGCTGGCTCGTCTGGGGCAGCAAGTTCACGGCGTACCGGGCGCGGCCGCTGCCGTTCGACGCC
TACGACGAGGTCGAGACGGCGGTGCGGGAGCAGGTGGGCGGGATCCTGACGCGCGACTGGGTCGCGCGCTGCTTC
GAGTACTTCAAGCAGGAGCCGCGGGACCAGTCGACGGACCGGTTCCGGATGAGCTACGTCTACCTGCTCATGCAC
GTCTTCGACCTGATGCACTACGGCAAGACGGCCGTGACGCTCGGCGACGTCGAGGAGCTGACGCGCGCCGTGTAC
GGCGACGGGAGCGACAAGCACCAGCACCGGGCGACGTCGGAGATCCTGGGGGCGCTGCTGGCGGGCTCGAGCGAC
GACCCGCTCGAGATCCGCGACCGCGTCTGGCGCTTCGCGGCGCCCATGATGCTGCAGATCGTCGCCGACGACCTG
ACGCCGGAGAACCTGCAGTACTGGCTGACGTGCCTGCACTTCGTGCTCGACGCCAAGGACCCGCGGCGGTCGCAC
GAGATCGTGGACCGGCTCAAGTCGATCCGGCTCGACATGACGTCCAACGCGGCCTTCAAGGAGTCGTCCAAGGTG
CAGCTGGTCGAGTTCGTGGTGGCGGACGGCGGCTGGCACTTCCGCGACGCCAAGCCGATCCTCGACCACTTCGCC
GCGCACATCGACCACCCGTACAAGGCGGTGCGCGAGGCCATCGGCCGGCTGCTGTCGGCCATCGAGAAGTCGCGC
TACTACGAGTGCTTCGAGAGCGTGCCCAAGCTGCTCGAGGACAACAAGCGGGCGTCGTCGATCGGGATCCGGCCC
TACCGGCCGTCGGCGGAGCTGGCGGCGACGGTCGCCGACGTCTTCGGCCGGCTCGAGAGGTGGCGGCTGGAGCGG
ACGCCGGGCCAGCAGACGCCGTCGTCGTACACGTCCGGGTCCAAGACGGTGCTCATGTGGCTCGACTGCACCCTG
TCGTCGCACGAGTGCATCGAGCTGGTGCCCTTCTTCGCCGAGCCCTTCATGGAGCAGCTGCTGCACATGATGGAC
GTCAAGGAGGACCCGGAGCTGATGAACGGCGCCTACCACGTGTACCGGCACCTGCCCAACATACCCTTCCGCAGC
GGCGAGGACGTCGAGTCGTCTACTTCCGGCGCATCTTCCTGA
Gene >Hirsu2|1308
ATGGACGAGAACATGGGCCTGCGGCGCGAGGGCTCCCACGCCGGGCTGGCGCCGTCGGCCGCCTCGCACCTGACG
ACGAGCTTCGCCCTGTACGAGCCCGTCTCGCGCGCCACGTCGCCCGGCACGCCCTACGCCAAGACGGACGAGGAC
GACAAGAAGCGCTACCGCCCCCGGACCTTTGCCTACTTCCAGCAGCTGCCCTTCGAGGTCGAGAAGGAGGCCCAG
CGCGACGCCGCCCTGCACGGCATCCTCAAGCAGCTCTACACCGCCGTCCGCGCCGAGGACTTCTCCCCGGGCGCC
CTGCACTGGACCCGCGAGCTGCAGGCCTGGCTCAACCTCAAGTTCGAGATGACGCGCGAGCTGCGCGCCCGCCTG
GCCAAGCTCTTTTACTCCCTCGCCCTGGCCCCGGGCTTGGATCACACTGCCGCCGACCGCTTCCTGCGCATGGTC
TTGACCCTCACCAGGTGCGTGTGATGATGATGATGGCCTCCTCCCCTCTCCTCCCCCCTCTCCTCCCCCCTCTCC
TCCCCCCCTACCTTTCCCCCCTTTCACCATTCCCCTCGCGGAGAGAAAAATGACATGGAAACGAGGCGGATCGGA
AGAATACAACCCTGCGTACAAGACCGGTCTCGCTAACGCGCCCCCCCCCCGTTCTGCTGGCAGGAAGAACCACTA
CCTCAAGCCCGTCGATGACCTCACCCTCGACTGGAGGCCGCTGTGGGCCGAGATCAAGGCCTGGGTCCTGCCGTC
CGAGGGCCCCGCCCACCAGAGCAGCCGCCGCCGGGGGGCCAAGCAGCTCCTCAAGCTCTGCCAGTACGCCCACGC
CTTCTTCGACCCCCGCGACCGGCCGGCCATACTCGAGGAGCTGCTGCCGTACTTCGGCGTCAACGAGCTGCCCAA
CGCCTTCATCGTCATCGGTGCCCTCAACGCCCTGCTGCCCAGCCATCCCGCCCCCGCCGACGAGCCGCTGGCCCA
GCCGCAGCACTTCCTGCCCACCCTCTTCCACCTGTGGTCCATCGTCAACCGCTCCAAGGTCGTCGACATGTTCTT
CATGGACCTCTTGTCCCGCCTGACCCGCGACCACATCCAGTGCGGCCACGTGCCCTTCTCCGAGTACGGCATCTT
CACCCGCGAGCAGTCGGACCTCGTCTTCACCGCCATGCTGCGCCTGACCCAGATCCCCGTCGGCCAGGCCAACTC
GCCCTACACCCCCGTCGACTACCTGTCCGGCGCCGGCGGCTACCTCGAGAAGGACAAGAAGAAGTACCCGGTCGC
CTACGTCATGGCCCGCCTCGTCACCAGCTGCCTCTCCCCCAAGTGCATGGACCAGCGCGAGTCCATCATGTCCAG
CCTCGAGGGCCTCATCGAGTCCATCGACACCTTCTTCCACCCCTCCAACCAGGGCGCCTGGACCACCATGCTCGG
CCAGTTCGTCCTCTACCTGACCGACAGCTTCGTCTCGCGCTGGAACCGGGAGCGGAGCGGCGAGCTCGACATACC
CCCGGACCGCAACATCACCCCCGCCCTCAAGCGCCGCTTCGTCCTCTCCCTCCGCGAGGTCACCTTCATGGGCCT
CTTCTCCAAGAGCGCGCGCGTCTCCCACTGCTACTACAACGCCCTGCAGGGCCTGGCCTACCTCGAGCCGGACCT
GGTGCTGCCCGGCGCCCTGCAGCGCTTCTACCCCAGCCTGCAGGGGCTCGTCGAGGTCCACCGCACGACGTCGAG
CCTCAACGGCCTGCAGATGATCGCCAGCATCATGTGCCGCCTCAAGGGCTACCGCTGCCACGTCACGGCCCTCCT
GGCCCTCGCCCTGCCGGGCATCGACGCCAACGACCTCAACAAGACGCAGTACACGCTCAACTTCATCCAGAGCGT
CGCCTACAGCGTCCCCTTCGTGCCCATGACGAGCGACGCCAGCCACATCCACGACACCACCCTCGCCATGCAGTG
GGTCCAGGCCGAGATGGACCGCATGGAGCGCGACGGCCAGAACGTCCAGATCGACTACCAGTCCGAGCTCAGCGA
CGAGGACGAGACCAACATCCTGCGCTCCTCCACCGCCGGCTTCGGCGAGTTCGTCCTGACGCTCCTCGGCAAGAT
CTTCACGCTGCTGGAGAACCTGCCGGACGCGAACCAGGTCCGCGGCGGCACGCCCGAGGACAACGTCATCAACGC
CCTGCCCGCCGCCCTCTCGCCCCTCTTCGCCTCGCTCTCCCCCGACATCTTCGACATGGCGCTCGACAAGATCGC
GACCTTCGTCTCGAGCCACGTCGTGCACCAGGCGCGCGACGCCATGGCCTGGATCCTCAACGCCCTCTGCAAGGT
CAGCCCGGAGAAGACGCTCAAGGTCTTCGTGCCCATGCTCGTCGTCAACATCCGCAACGAGATCGACTACAACAA
CGCGGCCTCGGACCGCACCACCGGCACCGACTACCTGCCGCGCGACCGCGCCCTCGTCTGGCACGTGAGCATGCT
CGCCATGGCCGTCGTCCACGTCGGCAGCGAGGTGCTCCGCTACCGCGACGAGCTGCTCGGCGTCGCCGAGTACAT
GCAGGACAAGTGCCGCGGCCTGCCCACCATCCTCGTCTCCAACTACATCCACCACCTGCTGCTCAACCTGACGCA
CACCTACCCCATCGACCACGCCCTCTTCGAGCCCGACGTCATGCGGAGGGGGCTCGACATCGGCGACTGGGGCAA
GACGACGGCCGCCGCCGACCTCACCATCCGCTGGCACCAGCCGTCGCCCGCCGAGATCGAGTTCGCCGTCGAGCT
GTTCGCCTCGCAGGTCACGTCGGCCGTCCGGCAGCTGGAGCTGCTCATGAGCGACGACCCCCCCGTCAGCAGGGA
GGGCAAGAACAAGGCCTGGTCGGACGAGGTGTCGAGGCTCATGCAGCAGATCCGCCTGGTCATCGCCGGCATGGC
CACCATGTTCGACCCGAAGCGCGCGTCTGGCGGCGGCCAAAGAAACGGCGAAGCTGGCCAAGGCGCCGCCGCCGC
CGCCGACGCCCCGGGAGACGGTGACGAGGCGATGATGATGATGATGATGGACGACGGCGACGGCGACGTTGGCGG
CGGCGGCGGCGGCGGCGGCGACGACGACGACGACGACGACGACGACGCGCTGGCCGAAGACGCCGACGACGAGGA
GCTGCGGCCCCAGTTCCGCTACAAGGCCGGGTACCTGCTGAAGCCCGGCGACGCGGCGTACGAGCGGATCCACGA
GCTGCGCGACGAGCTGGGCCACCTCCTGACCAAGGCGCACGCCTTCCTGGCCGAGAAGCAGGAGGACGACGTCAA
CTGCTTCACCGCCCTGTGCTCGGCCTACCGCACCTGGATCACGGACGTGGGCATCGAGAGGTCCGCCCACCCGCT
CGAGAGGCACCTCCGGCTGTACAAGGCGGACATCGCGGCCTTCAAGATCAAGGGCCTGCGCAAGGTGTACCCGCG
CCCGCTGCTGATCAAGCGCGCCGAGGCGTACCACATCCTGCGCATGAAGCACAACGCGTCGGCCCGGCACAAGAG
CGAGCTGGACAGGCGGCTCCTGCTCGACCTCGCGCAGCTGTGCCTGTCGCTGTACGCCGACGTCCGCCGGGTGGC
GCAGAGCGCGCAGGACTCGTCGCTCAAGGCCCTCATCGGCGGCAAGCCCGTCGTGATACCCGTCATCCTCGACGG
CCTCGGCGCCGCCATCCGGACCAACGAGCACGACCGGATCAAGGGCGGCATGTACACCCTGCTCTTCACCTCGCT
GCTGCGGACCGTGCTCCGGGACTGGCGCTTCGCGCCCGAGGCGATGCGGCTGTACATCGAGACGGCGGGCATCGA
CAAGCCGTCCATCCAGAACCTGGGCTCCACCGCCCTCTACTCCATGTTCGAGTTCGGCAAGCCGCTCGAGCGCGC
CATCCTGGTCGACGACGCCGTCGTCGACAGCATCCGGCCCCAGGCCGACGTCTCGGCCGCCGTCGAGAAGCGGCA
CGCCTTCATCGTGCAGCGGCGCGGCCGGGTCGAGAGCGCCAAGGCGGCGCTGGGCCTGGAGCTGACGCGGCGGGC
GAGGGGCGCCCACTGGAAGATCGCGACGCGGTGCGCCATCTTCGCCACCAACCTGTGCCTGCGCTTCGACGACGT
GGCGCCGTCCGAGTTCGTCGAGCTGGTCGCGCGCGGCACCAACGACCCGCACCCGAGCCTGAGAGGCTACTACCT
CAACGCCTTCACCTCGCTCTTCACCATGATCGACATGCGGGCCGTCTACGGCCACGACTACACCAACTACCTGCT
CGAGCGCGAGACGGGCGACCGGAACCGGCTCGAGGTACCGGTGGCCAAGGGCGACGCCGCCTTCACCGAGCGCTT
CCTCGAGGCCTTCCGGCAGCAGCCCGAGGGCGCCGAGTACCTGGTCGACTTCGACCACCCGGGCTGGCTCGTCTG
GGGCAGCAAGTTCACGGCGTACCGGGCGCGGCCGCTGCCGTTCGACGCCTACGACGAGGTCGAGACGGCGGTGCG
GGAGCAGGTGGGCGGGATCCTGACGCGCGACTGGGTCGCGCGCTGCTTCGAGTACTTCAAGCAGGAGCCGCGGGA
CCAGTCGACGGACCGGTTCCGGATGAGCTACGTCTACCTGCTCATGCACGTCTTCGACCTGATGCACTACGGCAA
GACGGCCGTGACGCTCGGCGACGTCGAGGAGCTGACGCGCGCCGTGTACGGCGACGGGAGCGACAAGCACCAGCA
CCGGGCGACGTCGGAGATCCTGGGGGCGCTGCTGGCGGGCTCGAGCGACGACCCGCTCGAGATCCGCGACCGCGT
CTGGCGCTTCGCGGCGCCCATGATGCTGCAGATCGTCGCCGACGACCTGACGCCGGAGAACCTGCAGTACTGGCT
GACGTGCCTGCACTTCGTGCTCGACGCCAAGGACCCGCGGCGGTCGCACGAGATCGTGGACCGGCTCAAGTCGAT
CCGGCTCGACATGACGTCCAACGCGGCCTTCAAGGAGTCGTCCAAGGTGCAGCTGGTCGAGTTCGTGGTGGCGGA
CGGCGGCTGGCACTTCCGCGACGCCAAGCCGATCCTCGACCACTTCGCCGCGCACATCGACCACCCGTACAAGGC
GGTGCGCGAGGCCATCGGCCGGCTGCTGTCGGCCATCGAGAAGTCGCGCTACTACGAGTGCTTCGAGAGCGTGCC
CAAGCTGCTCGAGGACAACAAGCGGGCGTCGTCGATCGGGATCCGGCCCTACCGGCCGTCGGCGGAGCTGGCGGC
GACGGTCGCCGACGTCTTCGGCCGGCTCGAGAGGTGGCGGCTGGAGCGGACGCCGGGCCAGCAGACGCCGTCGTC
GTACACGTCCGGGTCCAAGACGGTGCTCATGTGGCTCGACTGCACCCTGTCGTCGCACGAGTGCATCGAGCTGGT
GCCCTTCTTCGCCGAGCCCTTCATGGAGCAGCTGCTGCACATGATGGACGTCAAGGAGGACCCGGAGCTGATGAA
CGGCGCCTACCACGTGTACCGGCACCTGCCCAACATACCCTTCCGCAGCGGCGAGGACGTCGAGTTCATCGAGGG
CCTGATCCGGGTCGGGCGGGCGGCGGCGAGCTGGCACCAGCGGCTGCGCGCCCTCGTCAACATGCAGGTCGTCTA
CTTCCGGCGCATCTTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail