Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1302
Gene name
LocationContig_1285:3142..6548
Strand+
Gene length (bp)3406
Transcript length (bp)3207
Coding sequence length (bp)3207
Protein length (aa) 1069

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10366 Vps39_1 Vacuolar sorting protein 39 domain 1 3.1E-32 626 732
PF10367 Vps39_2 Vacuolar sorting protein 39 domain 2 1.9E-26 927 1049
PF00780 CNH CNH domain 1.2E-11 96 344

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13955|VAM6_SCHPO Vacuolar morphogenesis protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vam6 PE=3 SV=1 99 1047 7.0E-63
sp|Q96JC1|VPS39_HUMAN Vam6/Vps39-like protein OS=Homo sapiens GN=VPS39 PE=1 SV=2 552 1047 5.0E-48
sp|Q8R5L3|VPS39_MOUSE Vam6/Vps39-like protein OS=Mus musculus GN=Vps39 PE=1 SV=1 552 1047 4.0E-47
sp|Q96JC1|VPS39_HUMAN Vam6/Vps39-like protein OS=Homo sapiens GN=VPS39 PE=1 SV=2 1 456 4.0E-28
sp|Q8R5L3|VPS39_MOUSE Vam6/Vps39-like protein OS=Mus musculus GN=Vps39 PE=1 SV=1 1 456 4.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13955|VAM6_SCHPO Vacuolar morphogenesis protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vam6 PE=3 SV=1 99 1047 7.0E-63
sp|Q96JC1|VPS39_HUMAN Vam6/Vps39-like protein OS=Homo sapiens GN=VPS39 PE=1 SV=2 552 1047 5.0E-48
sp|Q8R5L3|VPS39_MOUSE Vam6/Vps39-like protein OS=Mus musculus GN=Vps39 PE=1 SV=1 552 1047 4.0E-47
sp|Q96JC1|VPS39_HUMAN Vam6/Vps39-like protein OS=Homo sapiens GN=VPS39 PE=1 SV=2 1 456 4.0E-28
sp|Q8R5L3|VPS39_MOUSE Vam6/Vps39-like protein OS=Mus musculus GN=Vps39 PE=1 SV=1 1 456 4.0E-28
sp|Q07468|VAM6_YEAST Vacuolar morphogenesis protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAM6 PE=1 SV=1 567 1047 2.0E-26
sp|A4IG72|TGFA1_DANRE Transforming growth factor-beta receptor-associated protein 1 homolog OS=Danio rerio GN=tgfbrap1 PE=2 SV=1 626 1050 1.0E-20
sp|Q3UR70|TGFA1_MOUSE Transforming growth factor-beta receptor-associated protein 1 OS=Mus musculus GN=Tgfbrap1 PE=1 SV=1 626 1047 4.0E-18
sp|Q8WUH2|TGFA1_HUMAN Transforming growth factor-beta receptor-associated protein 1 OS=Homo sapiens GN=TGFBRAP1 PE=1 SV=1 552 1047 2.0E-17
sp|A7MB11|TGFA1_BOVIN Transforming growth factor-beta receptor-associated protein 1 OS=Bos taurus GN=TGFBRAP1 PE=2 SV=1 593 1047 2.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1302
MLSAFTARPIIELRPRDKSKIETILAYGDRILVGLNSGALRVYRLNELCAPQDNPSSPPLSSEETAHETAKATQN
GQGSSPKQHASKKPTDLLREVEKFSTRAIEQLAIIKEANIIISLSNYQVSFYDLQTYEYIETLSRSKNASCFAVT
SNIVKDPETGIPEIISRLAVAVKRRLFLWSWHESELGDDVGEVVLSESIRTVTWANATKLVCGMNGGYVMVDSLT
YQFEDIVSPGMVGAGSQGSRFGTVSSAGMGYMGLGGYMPKPLAAKLADGEILLAKDINTLFIKDDGKPLERRQIP
WPSSPEFIGYSYPYIVALQSPSKGFLEVRNPDTLSLLQSISLPGAAQLHFPPPTVSLAHAGKGFHISSERCVWKM
AATGYDSQVDELVHGGMFDEAVSVLNMLEDALLKNKKETLREVKMLKAEMLFSQKRFRKAMDLMNEDDVHAPPER
VLMFYPPQIAGELSRWAHLEDDGGVQGLWTVKTNGTAAVESSEGLVDHLLPQPIGGFAKLFRGASKKTQSDAASV
ASGRKETVEDDDMEGAKEAANKEDRPLEGKELIKAVLELNSYLAGTRARLQRVLDPVTAKLKPQPDRQDSVEEAG
ERFLRTSQNESEQKLEEELRETFRLVDTTLFRSYMLSQPSLAGSLFRIPNFCDPSVVNEKLLEHNRFTELVDFFY
GKRMHKDALELLHRFGSARKPDEAAPALHGPDRTIQYLQNLPPSEIDVILEHAAWTLESNPDYAMEIFVGDTENA
ETMPRDKVISFLQEMDTNLERHYLEHIIDELEDMTPDFHNRLAELYVEHLAGAEKGDGWDGLMDKLLRFLRGSRQ
IYSLTKALGLMPKDDPSFYEARAVVLSNMGEHREALEIYVFKMKDFAKAEEYCNRLHKSQETFVSPGASPALEDP
TKSTYHTLLSLYMKPPFPYKKLLEPALDLLSKHGSRLPATSTLSLIPDNLPIGALEAYFRGRIRSVTSLVNESRI
VANLRKAEGISVAARLHLGDDATGGQGGRNRHVIITDERHCVVCHKKLGGVMRIGGSVMAVLPDNTVVHYGCLNR
ATGQKSDKLQAPSWAKGL*
Coding >Hirsu2|1302
ATGCTCTCCGCCTTTACGGCGCGGCCGATTATCGAGCTTCGACCCCGCGACAAGTCCAAGATTGAAACTATCCTA
GCATATGGCGACCGCATCCTCGTCGGCCTCAACAGCGGTGCACTTCGCGTATATCGCCTGAATGAGCTCTGCGCT
CCGCAGGACAATCCTTCCTCCCCCCCTCTCTCTTCCGAGGAAACCGCCCACGAAACAGCCAAGGCTACCCAAAAC
GGACAAGGATCGTCGCCGAAACAACATGCGTCTAAAAAGCCGACGGACCTGCTGCGCGAGGTCGAGAAGTTTTCA
ACGCGCGCGATCGAGCAACTTGCCATCATAAAAGAAGCGAACATCATTATCTCGCTCTCCAACTACCAAGTTTCC
TTCTACGACCTGCAAACATACGAGTACATCGAGACACTGAGCCGGTCTAAGAACGCTTCCTGCTTCGCCGTGACC
TCCAACATCGTCAAAGATCCCGAAACTGGCATCCCCGAAATCATCAGCCGCCTGGCTGTCGCCGTCAAGCGGCGC
TTGTTCCTATGGAGCTGGCACGAAAGCGAGCTAGGCGACGATGTCGGCGAAGTGGTTCTCTCCGAGTCGATCCGG
ACAGTGACGTGGGCGAACGCGACAAAGCTTGTTTGCGGCATGAATGGAGGTTACGTCATGGTCGACTCTCTCACC
TATCAATTCGAAGACATCGTGAGCCCCGGCATGGTGGGGGCTGGCAGCCAGGGAAGCCGGTTCGGTACGGTCAGC
AGCGCAGGGATGGGCTATATGGGCTTGGGGGGATACATGCCTAAGCCGCTGGCCGCAAAGCTGGCCGATGGCGAG
ATACTGCTTGCCAAAGACATTAACACGCTTTTCATCAAGGATGACGGGAAGCCGCTCGAGAGGAGGCAGATACCG
TGGCCGTCGTCCCCCGAATTCATCGGCTATTCTTACCCCTATATCGTTGCGCTCCAGTCACCATCAAAGGGCTTC
CTGGAGGTTCGTAACCCGGACACGTTGTCCTTATTACAGAGCATATCGCTTCCCGGGGCCGCTCAACTCCACTTC
CCCCCTCCGACCGTGAGCCTCGCTCACGCCGGCAAGGGATTCCATATCTCGAGCGAGCGATGCGTTTGGAAGATG
GCAGCAACGGGTTACGACTCACAAGTGGATGAACTCGTCCACGGCGGCATGTTTGACGAAGCTGTGAGCGTCCTG
AACATGCTGGAGGATGCACTGCTCAAGAACAAAAAGGAGACGCTCCGTGAAGTCAAGATGCTCAAGGCCGAGATG
CTATTCAGCCAGAAAAGGTTTCGGAAAGCTATGGACCTGATGAACGAGGACGACGTCCATGCACCCCCAGAGAGA
GTTCTTATGTTTTATCCACCGCAAATAGCGGGAGAGCTGTCACGCTGGGCACACCTGGAGGACGACGGCGGAGTC
CAAGGCCTCTGGACAGTCAAGACGAACGGAACGGCCGCGGTGGAAAGCTCGGAGGGCCTGGTCGACCACCTGCTA
CCACAGCCCATTGGTGGCTTCGCCAAGCTGTTCAGGGGCGCTAGTAAGAAAACCCAGTCAGACGCGGCGTCCGTC
GCTTCGGGCAGAAAGGAGACTGTGGAGGACGATGACATGGAGGGCGCCAAGGAAGCTGCCAATAAAGAGGATCGG
CCGCTGGAGGGAAAAGAGCTGATAAAAGCGGTCCTGGAGCTGAACAGCTACCTCGCGGGCACTCGGGCGCGCCTC
CAACGAGTCCTCGATCCTGTGACGGCGAAGTTGAAGCCTCAGCCAGATAGGCAGGATTCGGTCGAGGAGGCGGGT
GAGAGATTCCTGCGGACGTCGCAAAACGAGTCGGAGCAGAAGCTTGAGGAGGAGCTGCGCGAGACCTTCCGGCTG
GTTGACACGACGCTCTTCCGCTCCTACATGTTATCGCAGCCGTCGCTGGCCGGCTCTCTTTTTCGGATTCCAAAC
TTTTGCGACCCAAGCGTCGTCAACGAGAAGCTTCTAGAGCACAACAGGTTCACAGAGTTGGTGGACTTTTTCTAC
GGCAAGAGGATGCACAAGGACGCCCTCGAACTACTCCATAGGTTCGGGTCGGCGAGGAAGCCCGACGAGGCGGCG
CCTGCTCTTCACGGGCCAGACCGCACGATCCAATACCTGCAGAATTTGCCGCCCTCGGAGATAGACGTCATCCTG
GAGCACGCTGCTTGGACGCTCGAGAGCAACCCTGACTACGCCATGGAGATATTTGTTGGCGACACGGAGAATGCA
GAAACGATGCCCCGGGACAAGGTGATATCTTTCCTACAAGAGATGGACACCAACCTGGAGAGGCACTACTTGGAA
CATATCATCGACGAACTTGAGGATATGACGCCAGATTTCCACAACCGCTTGGCGGAATTGTACGTGGAGCACCTC
GCCGGAGCGGAGAAAGGTGACGGATGGGATGGTCTCATGGACAAGCTCCTCCGGTTCCTGCGAGGATCGCGGCAG
ATATACAGTTTAACCAAAGCACTTGGATTGATGCCAAAAGACGACCCGTCTTTCTACGAGGCTCGAGCGGTCGTC
CTGAGCAACATGGGAGAGCACAGAGAGGCACTGGAGATCTATGTCTTCAAAATGAAGGATTTTGCTAAGGCTGAA
GAGTATTGCAACCGCCTGCACAAATCGCAGGAAACGTTCGTCTCGCCTGGCGCCAGTCCAGCACTCGAGGATCCG
ACGAAATCGACGTACCATACCCTGCTGTCGCTCTACATGAAACCGCCGTTTCCCTACAAGAAGCTGCTGGAGCCG
GCGCTGGACCTTCTCTCCAAGCATGGCTCGCGACTGCCGGCCACGTCGACGTTGAGCTTAATCCCAGACAATCTA
CCCATTGGCGCGCTCGAAGCCTATTTCCGAGGCCGCATACGGTCAGTCACCAGCCTCGTAAACGAGTCTCGCATC
GTTGCCAACCTGCGCAAGGCGGAAGGCATATCCGTGGCGGCTCGCCTGCACCTGGGCGACGACGCAACGGGCGGG
CAGGGCGGGCGCAACAGACACGTCATCATCACCGACGAAAGGCACTGCGTTGTTTGCCACAAGAAGCTTGGTGGG
GTCATGCGGATCGGCGGGAGCGTGATGGCCGTCCTGCCGGACAACACGGTGGTGCATTATGGCTGTCTGAACAGA
GCCACTGGGCAGAAGTCGGACAAGTTACAGGCGCCAAGCTGGGCGAAGGGCCTCTAG
Transcript >Hirsu2|1302
ATGCTCTCCGCCTTTACGGCGCGGCCGATTATCGAGCTTCGACCCCGCGACAAGTCCAAGATTGAAACTATCCTA
GCATATGGCGACCGCATCCTCGTCGGCCTCAACAGCGGTGCACTTCGCGTATATCGCCTGAATGAGCTCTGCGCT
CCGCAGGACAATCCTTCCTCCCCCCCTCTCTCTTCCGAGGAAACCGCCCACGAAACAGCCAAGGCTACCCAAAAC
GGACAAGGATCGTCGCCGAAACAACATGCGTCTAAAAAGCCGACGGACCTGCTGCGCGAGGTCGAGAAGTTTTCA
ACGCGCGCGATCGAGCAACTTGCCATCATAAAAGAAGCGAACATCATTATCTCGCTCTCCAACTACCAAGTTTCC
TTCTACGACCTGCAAACATACGAGTACATCGAGACACTGAGCCGGTCTAAGAACGCTTCCTGCTTCGCCGTGACC
TCCAACATCGTCAAAGATCCCGAAACTGGCATCCCCGAAATCATCAGCCGCCTGGCTGTCGCCGTCAAGCGGCGC
TTGTTCCTATGGAGCTGGCACGAAAGCGAGCTAGGCGACGATGTCGGCGAAGTGGTTCTCTCCGAGTCGATCCGG
ACAGTGACGTGGGCGAACGCGACAAAGCTTGTTTGCGGCATGAATGGAGGTTACGTCATGGTCGACTCTCTCACC
TATCAATTCGAAGACATCGTGAGCCCCGGCATGGTGGGGGCTGGCAGCCAGGGAAGCCGGTTCGGTACGGTCAGC
AGCGCAGGGATGGGCTATATGGGCTTGGGGGGATACATGCCTAAGCCGCTGGCCGCAAAGCTGGCCGATGGCGAG
ATACTGCTTGCCAAAGACATTAACACGCTTTTCATCAAGGATGACGGGAAGCCGCTCGAGAGGAGGCAGATACCG
TGGCCGTCGTCCCCCGAATTCATCGGCTATTCTTACCCCTATATCGTTGCGCTCCAGTCACCATCAAAGGGCTTC
CTGGAGGTTCGTAACCCGGACACGTTGTCCTTATTACAGAGCATATCGCTTCCCGGGGCCGCTCAACTCCACTTC
CCCCCTCCGACCGTGAGCCTCGCTCACGCCGGCAAGGGATTCCATATCTCGAGCGAGCGATGCGTTTGGAAGATG
GCAGCAACGGGTTACGACTCACAAGTGGATGAACTCGTCCACGGCGGCATGTTTGACGAAGCTGTGAGCGTCCTG
AACATGCTGGAGGATGCACTGCTCAAGAACAAAAAGGAGACGCTCCGTGAAGTCAAGATGCTCAAGGCCGAGATG
CTATTCAGCCAGAAAAGGTTTCGGAAAGCTATGGACCTGATGAACGAGGACGACGTCCATGCACCCCCAGAGAGA
GTTCTTATGTTTTATCCACCGCAAATAGCGGGAGAGCTGTCACGCTGGGCACACCTGGAGGACGACGGCGGAGTC
CAAGGCCTCTGGACAGTCAAGACGAACGGAACGGCCGCGGTGGAAAGCTCGGAGGGCCTGGTCGACCACCTGCTA
CCACAGCCCATTGGTGGCTTCGCCAAGCTGTTCAGGGGCGCTAGTAAGAAAACCCAGTCAGACGCGGCGTCCGTC
GCTTCGGGCAGAAAGGAGACTGTGGAGGACGATGACATGGAGGGCGCCAAGGAAGCTGCCAATAAAGAGGATCGG
CCGCTGGAGGGAAAAGAGCTGATAAAAGCGGTCCTGGAGCTGAACAGCTACCTCGCGGGCACTCGGGCGCGCCTC
CAACGAGTCCTCGATCCTGTGACGGCGAAGTTGAAGCCTCAGCCAGATAGGCAGGATTCGGTCGAGGAGGCGGGT
GAGAGATTCCTGCGGACGTCGCAAAACGAGTCGGAGCAGAAGCTTGAGGAGGAGCTGCGCGAGACCTTCCGGCTG
GTTGACACGACGCTCTTCCGCTCCTACATGTTATCGCAGCCGTCGCTGGCCGGCTCTCTTTTTCGGATTCCAAAC
TTTTGCGACCCAAGCGTCGTCAACGAGAAGCTTCTAGAGCACAACAGGTTCACAGAGTTGGTGGACTTTTTCTAC
GGCAAGAGGATGCACAAGGACGCCCTCGAACTACTCCATAGGTTCGGGTCGGCGAGGAAGCCCGACGAGGCGGCG
CCTGCTCTTCACGGGCCAGACCGCACGATCCAATACCTGCAGAATTTGCCGCCCTCGGAGATAGACGTCATCCTG
GAGCACGCTGCTTGGACGCTCGAGAGCAACCCTGACTACGCCATGGAGATATTTGTTGGCGACACGGAGAATGCA
GAAACGATGCCCCGGGACAAGGTGATATCTTTCCTACAAGAGATGGACACCAACCTGGAGAGGCACTACTTGGAA
CATATCATCGACGAACTTGAGGATATGACGCCAGATTTCCACAACCGCTTGGCGGAATTGTACGTGGAGCACCTC
GCCGGAGCGGAGAAAGGTGACGGATGGGATGGTCTCATGGACAAGCTCCTCCGGTTCCTGCGAGGATCGCGGCAG
ATATACAGTTTAACCAAAGCACTTGGATTGATGCCAAAAGACGACCCGTCTTTCTACGAGGCTCGAGCGGTCGTC
CTGAGCAACATGGGAGAGCACAGAGAGGCACTGGAGATCTATGTCTTCAAAATGAAGGATTTTGCTAAGGCTGAA
GAGTATTGCAACCGCCTGCACAAATCGCAGGAAACGTTCGTCTCGCCTGGCGCCAGTCCAGCACTCGAGGATCCG
ACGAAATCGACGTACCATACCCTGCTGTCGCTCTACATGAAACCGCCGTTTCCCTACAAGAAGCTGCTGGAGCCG
GCGCTGGACCTTCTCTCCAAGCATGGCTCGCGACTGCCGGCCACGTCGACGTTGAGCTTAATCCCAGACAATCTA
CCCATTGGCGCGCTCGAAGCCTATTTCCGAGGCCGCATACGGTCAGTCACCAGCCTCGTAAACGAGTCTCGCATC
GTTGCCAACCTGCGCAAGGCGGAAGGCATATCCGTGGCGGCTCGCCTGCACCTGGGCGACGACGCAACGGGCGGG
CAGGGCGGGCGCAACAGACACGTCATCATCACCGACGAAAGGCACTGCGTTGTTTGCCACAAGAAGCTTGGTGGG
GTCATGCGGATCGGCGGGAGCGTGATGGCCGTCCTGCCGGACAACACGGTGGTGCATTATGGCTGTCTGAACAGA
GCCACTGGGCAGAAGTCGGACAAGTTACAGGCGCCAAGCTGGGCGAAGGGCCTCTAG
Gene >Hirsu2|1302
ATGCTCTCCGCCTTTACGGCGCGGCCGATTATCGAGCTTCGACCCCGCGACAAGTCCAAGATTGAAACTATCCTA
GCATATGGTAAGAGATCTGCGCACCTGTCTGCGGCCACGTCTGTCAGGGCGAAGTGGTGGTGGCCGTGACTAGCC
CGGAAGCTGATCGCAAGCTATAGGCGACCGCATCCTCGTCGGCCTCAACAGCGGTGCACTTCGCGTATATCGCCT
GAATGAGCTCTGCGCTCCGCAGGACAATCCTTCCTCCCCCCCTCTCTCTTCCGAGGAAACCGCCCACGAAACAGC
CAAGGCTACCCAAAACGGACAAGGATCGTCGCCGAAACAACATGCGTCTAAAAAGCCGACGGACCTGCTGCGCGA
GGTCGAGAAGTTTTCAACGCGCGCGATCGAGCAACTTGCCATCATAAAAGAAGCGAACATCATTATCTCGCTCTC
CAACTACCAAGTTTCCTTCTACGACCTGCAAACATACGAGTACATCGAGACACTGAGCCGGTCTAAGAACGCTTC
CTGCTTCGCCGTGACCTCCAACATCGTCAAAGATCCCGAAACTGGCATCCCCGAAATCATCAGCCGCCTGGCTGT
CGCCGTCAAGCGGCGCTTGTTCCTATGGAGCTGGCACGAAAGCGAGCTAGGCGACGATGTCGGCGAAGTGGTTCT
CTCCGAGTCGATCCGGACAGTGACGTGGGCGAACGCGACAAAGCTTGTTTGCGGCATGAATGGAGGTTACGTCAT
GGTCGACTCTCTCACCTATCAATTCGAAGACATCGTGAGCCCCGGCATGGTGGGGGCTGGCAGCCAGGGAAGCCG
GTTCGGTACGGTCAGCAGCGCAGGGATGGGCTATATGGGCTTGGGGGGATACATGCCTAAGCCGCTGGCCGCAAA
GCTGGCCGATGGCGAGATACTGCTTGCCAAAGACATTAACACGCTTTTCATCAAGGATGACGGGAAGCCGCTCGA
GAGGAGGCAGATACCGTGGCCGTCGTCCCCCGAATTCATCGGCTATTCTTACCCCTATATCGTTGCGCTCCAGTC
ACCATCAAAGGGCTTCCTGGAGGTTCGTAACCCGGACACGTTGTCCTTATTACAGAGCATATCGCTTCCCGGGGC
CGCTCAACTCCACTTCCCCCCTCCGACCGTGAGCCTCGCTCACGCCGGCAAGGGATTCCATATCTCGAGCGAGCG
ATGCGTTTGGAAGATGGCAGCAACGGGTTACGACTCACAAGTGGATGAACTCGTCCACGGCGGCATGTTTGACGA
AGCTGTGAGCGTCCTGAACATGCTGGAGGATGCACTGCTCAAGAACAAAAAGGAGACGCTCCGTGAAGTCAAGAT
GCTCAAGGCCGAGATGCTATTCAGCCAGAAAAGGTTTCGGAAAGCTATGGACCTGATGAACGAGGACGACGTCCA
TGCACCCCCAGAGAGAGTTCTTATGTTTTATCCACCGCAAATAGCGGGAGAGCTGTCACGCTGGGCACACCTGGA
GGACGACGGCGGAGTCCAAGGCCTCTGGACAGTCAAGACGAACGGAACGGCCGCGGTGGAAAGCTCGGAGGGCCT
GGTCGACCACCTGCTACCACAGCCCATTGGTGGCTTCGCCAAGCTGTTCAGGGGCGCTAGTAAGAAAACCCAGTC
AGACGCGGCGTCCGTCGCTTCGGGCAGAAAGGAGACTGTGGAGGACGATGACATGGAGGGCGCCAAGGAAGCTGC
CAATAAAGAGGATCGGCCGCTGGAGGGAAAAGAGCTGATAAAAGCGGTCCTGGAGCTGAACAGCTACCTCGCGGG
CACTCGGGCGCGCCTCCAACGAGTCCTCGATCCTGTGACGGCGAAGTTGAAGCCTCAGCCAGATAGGCAGGATTC
GGTCGAGGAGGCGGGTGAGAGATTCCTGCGGACGTCGCAAAACGAGTCGGAGCAGAAGCTTGAGGAGGAGCTGCG
CGAGACCTTCCGGCTGGTTGACACGACGCTCTTCCGCTCCTACATGTTATCGCAGCCGTCGCTGGCCGGCTCTCT
TTTTCGGATTCCAAACTTTTGCGACCCAAGCGTCGTCAACGAGAAGCTTCTAGAGCACAACAGGTTCACAGAGTT
GGTGGACTTTTTCTACGGCAAGAGGATGCACAAGGACGCCCTCGAACTACTCCATAGGTTCGGGTCGGCGAGGAA
GCCCGACGAGGCGGCGCCTGCTCTTCACGGGCCAGACCGCACGATCCAATACCTGCAGAATTTGCCGCCCTCGGA
GATAGACGTCATCCTGGAGCACGCTGCTTGGACGCTCGAGAGCAACCCTGACTACGCCATGGAGATATTTGTTGG
CGACACGGAGAATGCAGAAACGATGCCCCGGGACAAGGTGATATCTTTCCTACAAGAGATGGACACCAACCTGGA
GAGGCACTACTTGGAACATATCATCGACGAACTTGAGGATATGACGCCAGATTTCCACAACCGCTTGGCGGAATT
GTACGTGGAGCACCTCGCCGGAGCGGAGAAAGGTGACGGATGGGATGGTCTCATGGACAAGCTCCTCCGGTTCCT
GCGAGGATCGCGGCAGATATACAGTTTAACCAAAGCACTTGGATTGATGCCAAAAGACGGTGAGAGTCACTCTGC
TCTGCGCAGCTGGCCCGGTACTGACGGGCCTCTAGACCCGTCTTTCTACGAGGCTCGAGCGGTCGTCCTGAGCAA
CATGGGAGAGCACAGAGAGGCACTGGAGATCTATGTCTTCAAAATGAAGGATTTTGCTAAGGCTGAAGAGTAAGT
CGACATCTCAGCTAGGGAAAGGCGGAACGAGCGCCTAACGAAGATGACCAGGTATTGCAACCGCCTGCACAAATC
GCAGGAAACGTTCGTCTCGCCTGGCGCCAGTCCAGCACTCGAGGATCCGACGAAATCGACGTACCATACCCTGCT
GTCGCTCTACATGAAACCGCCGTTTCCCTACAAGAAGCTGCTGGAGCCGGCGCTGGACCTTCTCTCCAAGCATGG
CTCGCGACTGCCGGCCACGTCGACGTTGAGCTTAATCCCAGACAATCTACCCATTGGCGCGCTCGAAGCCTATTT
CCGAGGCCGCATACGGTCAGTCACCAGCCTCGTAAACGAGTCTCGCATCGTTGCCAACCTGCGCAAGGCGGAAGG
CATATCCGTGGCGGCTCGCCTGCACCTGGGCGACGACGCAACGGGCGGGCAGGGCGGGCGCAACAGACACGTCAT
CATCACCGACGAAAGGCACTGCGTTGTTTGCCACAAGAAGCTTGGTGGGGTCATGCGGATCGGCGGGAGCGTGAT
GGCCGTCCTGCCGGACAACACGGTGGTGCATTATGGCTGTCTGAACAGAGCCACTGGGCAGAAGTCGGACAAGTT
ACAGGCGCCAAGCTGGGCGAAGGGCCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail