Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1301
Gene name
LocationContig_1285:588..2682
Strand+
Gene length (bp)2094
Transcript length (bp)1908
Coding sequence length (bp)1908
Protein length (aa) 636

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00939 Na_sulph_symp Sodium:sulfate symporter transmembrane region 1.6E-34 172 626
PF03600 CitMHS Citrate transporter 7.1E-26 206 567
PF03105 SPX SPX domain 5.8E-13 1 48

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59712|YBH4_SCHPO Uncharacterized transporter C3B8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.04c PE=3 SV=1 2 634 0.0E+00
sp|P27514|PHO91_YEAST Low-affinity phosphate transporter PHO91 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO91 PE=1 SV=2 2 634 0.0E+00
sp|P39535|PHO90_YEAST Low-affinity phosphate transporter PHO90 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO90 PE=1 SV=1 6 629 2.0E-155
sp|P25360|PHO87_YEAST Inorganic phosphate transporter PHO87 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO87 PE=1 SV=2 1 628 2.0E-154
sp|Q58086|Y672_METJA Uncharacterized transporter MJ0672 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0672 PE=3 SV=1 192 624 8.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59712|YBH4_SCHPO Uncharacterized transporter C3B8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.04c PE=3 SV=1 2 634 0.0E+00
sp|P27514|PHO91_YEAST Low-affinity phosphate transporter PHO91 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO91 PE=1 SV=2 2 634 0.0E+00
sp|P39535|PHO90_YEAST Low-affinity phosphate transporter PHO90 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO90 PE=1 SV=1 6 629 2.0E-155
sp|P25360|PHO87_YEAST Inorganic phosphate transporter PHO87 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO87 PE=1 SV=2 1 628 2.0E-154
sp|Q58086|Y672_METJA Uncharacterized transporter MJ0672 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0672 PE=3 SV=1 192 624 8.0E-25
sp|Q8LG88|TDT_ARATH Tonoplast dicarboxylate transporter OS=Arabidopsis thaliana GN=TDT PE=2 SV=2 195 625 1.0E-23
sp|Q49YW0|SDCS_STAS1 Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=sdcS PE=3 SV=1 197 586 5.0E-23
sp|Q57486|Y608_HAEIN Uncharacterized transporter HI_0608 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0608 PE=3 SV=1 177 626 5.0E-20
sp|Q2YU56|SDCS_STAAB Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=sdcS PE=3 SV=1 193 635 2.0E-19
sp|Q8NVS5|SDCS_STAAW Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain MW2) GN=sdcS PE=3 SV=1 197 635 3.0E-19
sp|Q6G816|SDCS_STAAS Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain MSSA476) GN=sdcS PE=3 SV=1 197 635 3.0E-19
sp|Q21339|NAD3_CAEEL Sodium-dependent high-affinity dicarboxylate transporter 3 OS=Caenorhabditis elegans GN=nac-3 PE=2 SV=3 191 586 1.0E-18
sp|Q2FFH9|SDCS_STAA3 Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain USA300) GN=sdcS PE=3 SV=1 197 635 1.0E-16
sp|Q7A4P8|SDCS_STAAN Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain N315) GN=sdcS PE=1 SV=1 197 635 1.0E-16
sp|Q99SX1|SDCS_STAAM Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=sdcS PE=1 SV=1 197 635 1.0E-16
sp|Q5HEK4|SDCS_STAAC Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain COL) GN=sdcS PE=3 SV=1 197 635 1.0E-16
sp|Q2FWY4|SDCS_STAA8 Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain NCTC 8325) GN=sdcS PE=3 SV=1 197 635 1.0E-16
sp|Q6GFE0|SDCS_STAAR Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain MRSA252) GN=sdcS PE=3 SV=1 197 586 7.0E-16
sp|Q93655|NAD1_CAEEL Sodium-dependent low-affinity dicarboxylate transporter 1 OS=Caenorhabditis elegans GN=nac-1 PE=2 SV=3 167 586 1.0E-14
sp|P32739|NAD2_CAEEL Sodium-dependent high-affinity dicarboxylate transporter 2 OS=Caenorhabditis elegans GN=nac-2 PE=2 SV=3 183 586 2.0E-11
sp|Q9VVT2|INDY1_DROME Protein I'm not dead yet OS=Drosophila melanogaster GN=Indy PE=1 SV=2 156 374 2.0E-10
sp|Q07252|MEMP_CUPNH Membrane protein OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=H16_A0667 PE=3 SV=2 195 629 2.0E-10
sp|Q67BT3|S13A5_MOUSE Solute carrier family 13 member 5 OS=Mus musculus GN=Slc13a5 PE=2 SV=1 172 401 1.0E-08
sp|Q8CJ44|S13A5_RAT Solute carrier family 13 member 5 OS=Rattus norvegicus GN=Slc13a5 PE=2 SV=1 197 422 3.0E-08
sp|Q8WWT9|S13A3_HUMAN Solute carrier family 13 member 3 OS=Homo sapiens GN=SLC13A3 PE=1 SV=1 163 342 3.0E-08
sp|Q86YT5|S13A5_HUMAN Solute carrier family 13 member 5 OS=Homo sapiens GN=SLC13A5 PE=1 SV=1 196 343 5.0E-08
sp|Q91Y63|S13A3_MOUSE Solute carrier family 13 member 3 OS=Mus musculus GN=Slc13a3 PE=1 SV=1 192 350 9.0E-08
sp|Q9Z0Z5|S13A3_RAT Solute carrier family 13 member 3 OS=Rattus norvegicus GN=Slc13a3 PE=2 SV=1 192 364 2.0E-07
sp|Q9VDQ0|INDY2_DROME Protein I'm not dead yet 2 OS=Drosophila melanogaster GN=Indy-2 PE=2 SV=2 197 411 3.0E-06
sp|Q9UKG4|S13A4_HUMAN Solute carrier family 13 member 4 OS=Homo sapiens GN=SLC13A4 PE=2 SV=2 194 339 4.0E-06
sp|Q9Z0Z5|S13A3_RAT Solute carrier family 13 member 3 OS=Rattus norvegicus GN=Slc13a3 PE=2 SV=1 480 590 6.0E-06
sp|Q8WWT9|S13A3_HUMAN Solute carrier family 13 member 3 OS=Homo sapiens GN=SLC13A3 PE=1 SV=1 480 590 7.0E-06
sp|Q9UBH6|XPR1_HUMAN Xenotropic and polytropic retrovirus receptor 1 OS=Homo sapiens GN=XPR1 PE=1 SV=1 2 93 7.0E-06
sp|Q9JHI4|S13A1_MOUSE Solute carrier family 13 member 1 OS=Mus musculus GN=Slc13a1 PE=2 SV=2 177 343 8.0E-06
sp|Q91Y63|S13A3_MOUSE Solute carrier family 13 member 3 OS=Mus musculus GN=Slc13a3 PE=1 SV=1 473 590 9.0E-06
sp|P46556|YKG6_CAEEL Uncharacterized transporter B0285.6 OS=Caenorhabditis elegans GN=B0285.6 PE=3 SV=2 479 562 9.0E-06
sp|Q9Z0U0|XPR1_MOUSE Xenotropic and polytropic retrovirus receptor 1 OS=Mus musculus GN=Xpr1 PE=1 SV=1 2 93 9.0E-06
sp|Q9R031|XPR1_MUSMC Xenotropic and polytropic retrovirus receptor 1 homolog OS=Mus musculus castaneus GN=Xpr1 PE=2 SV=1 2 93 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0006814 sodium ion transport Yes
GO:0016020 membrane Yes
GO:0005215 transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0015672 monovalent inorganic cation transport No
GO:0006811 ion transport No
GO:0006810 transport No
GO:0006812 cation transport No
GO:0030001 metal ion transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 163 185 22
2 198 220 22
3 253 275 22
4 306 328 22
5 343 362 19
6 383 405 22
7 425 442 17
8 449 471 22
9 481 503 22
10 522 544 22
11 564 586 22
12 606 628 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1301
MLKKRITSLYVQLCELKSYVQLNKTGFSKVLKKFDKILDKELKAVYMRTHVDTAYPFKDKTKRVVEDNIAKMEAA
YADIVTGGDAELAKKDLRSHLREHVVWERNTVWRDLIGIERRAEAARLGQSLLGQDQSVAPKRLQGDDGDLPARK
QFRTPLGRLSLPVWLASGFMLTLLASIAIFFALLFVPILAAPEQQNCLALLVFVSILWATETIPLFVTSLLIPFL
SVILRVVREEDPGKPRVRLDSPEATHAIFASMWTPVIMLLLGGFTLAAALSKCTIDKRLATLVLSKAGTQPKTVL
IANMAVAAFASMLISNVAAPVLCYSIIEPMLRTLPSDSNMSKAVIIGIALASNIGGMLSPIASPQNVVAMGIMQP
EPTWLQWFFIVIPVGVVSILLLWLLLLVSFQPGKGTTIAPIRPVKESFTGVQWFVSVITVVTIALWCASHQMEGV
FGDMGVIAIMPVVLFFGIGILTKEDFNNFPWTIIILAAGGLSLGKAVRSSGLLHLLAEMVSYKVQDMSKYGVLFV
FSVLILVIATFISHTVAALIFLPLVYDVGAAMDQPHPNLLVMGGVLMCSAAMGLPTSGFPNMTAIMKEDAAGQRY
LRVQHFISRGVPGSIITLIVVMTLGYGIMEVAGLD*
Coding >Hirsu2|1301
ATGCTCAAGAAGCGCATCACCAGCCTCTACGTCCAGCTGTGCGAGCTCAAGTCCTACGTTCAGCTGAACAAGACG
GGTTTCAGCAAGGTCCTGAAGAAATTTGACAAGATCCTCGACAAAGAACTCAAGGCCGTCTATATGCGCACCCAT
GTCGACACGGCCTACCCTTTCAAGGACAAGACGAAGCGCGTTGTCGAGGATAACATAGCCAAGATGGAGGCCGCT
TATGCAGACATCGTCACTGGAGGCGACGCGGAGCTTGCAAAGAAGGACTTGAGGTCGCATCTGCGGGAGCATGTC
GTCTGGGAGCGCAACACCGTGTGGAGGGACTTGATTGGCATTGAACGCAGAGCAGAAGCTGCCAGACTGGGGCAG
TCCCTACTGGGTCAGGACCAGAGTGTGGCACCGAAGCGCTTGCAGGGTGATGACGGCGACTTGCCCGCGCGCAAG
CAGTTCCGCACCCCGCTGGGCCGCCTGTCACTGCCCGTCTGGCTTGCCAGTGGGTTTATGCTTACGCTGCTCGCC
TCCATCGCAATCTTCTTTGCCCTTCTTTTTGTTCCCATACTGGCGGCGCCGGAGCAGCAAAACTGTTTGGCCTTG
CTCGTGTTCGTCAGCATCCTTTGGGCCACCGAGACGATTCCGCTCTTCGTAACGTCCCTGCTCATTCCCTTCCTA
TCCGTCATCCTGAGAGTTGTTCGTGAGGAAGACCCCGGCAAGCCCCGGGTGCGGCTCGACTCTCCGGAGGCGACA
CACGCCATATTTGCCTCCATGTGGACCCCGGTGATCATGCTATTGCTTGGAGGCTTCACCTTGGCTGCTGCGCTG
TCCAAGTGCACAATCGACAAGCGGCTTGCAACACTCGTCCTGAGCAAGGCCGGCACGCAACCAAAGACTGTCCTC
ATCGCAAACATGGCCGTCGCTGCCTTCGCGTCCATGCTTATCAGCAACGTGGCCGCTCCGGTCCTGTGCTACTCC
ATCATCGAACCAATGTTGCGAACGCTGCCTTCAGACTCCAACATGTCCAAGGCTGTCATCATAGGGATCGCCTTG
GCGTCCAATATTGGTGGCATGCTCTCCCCCATCGCATCACCGCAAAATGTAGTGGCCATGGGCATCATGCAGCCC
GAGCCTACCTGGCTGCAGTGGTTCTTTATCGTTATCCCGGTCGGTGTCGTGTCCATCCTTCTCCTCTGGCTGCTT
CTGCTGGTGTCGTTCCAGCCTGGCAAGGGCACGACGATCGCTCCGATCCGACCCGTGAAGGAGTCGTTCACCGGC
GTTCAGTGGTTTGTCTCGGTCATCACCGTCGTCACTATCGCGCTGTGGTGTGCCAGTCATCAAATGGAGGGCGTC
TTCGGCGACATGGGCGTAATTGCCATTATGCCAGTTGTGCTCTTTTTCGGAATTGGCATACTTACCAAGGAGGAC
TTCAACAACTTCCCCTGGACCATCATCATCCTGGCTGCGGGGGGCTTGTCCCTCGGCAAAGCGGTCAGGTCTTCG
GGTCTACTGCATCTCCTTGCGGAAATGGTGTCGTATAAGGTCCAGGACATGAGCAAATACGGCGTCTTGTTCGTC
TTCTCGGTCCTCATACTGGTCATTGCCACGTTCATCAGCCACACGGTTGCTGCACTTATCTTTCTGCCGCTCGTG
TATGACGTGGGTGCGGCCATGGACCAGCCGCACCCGAATCTACTCGTCATGGGAGGCGTTCTTATGTGCAGTGCG
GCCATGGGACTTCCTACCAGCGGCTTCCCCAACATGACTGCCATTATGAAGGAGGACGCCGCCGGTCAGAGATAT
TTGCGTGTGCAACATTTCATCAGCAGGGGAGTTCCCGGCAGTATTATCACACTCATCGTGGTAATGACTCTCGGC
TACGGCATCATGGAAGTAGCAGGGCTAGACTGA
Transcript >Hirsu2|1301
ATGCTCAAGAAGCGCATCACCAGCCTCTACGTCCAGCTGTGCGAGCTCAAGTCCTACGTTCAGCTGAACAAGACG
GGTTTCAGCAAGGTCCTGAAGAAATTTGACAAGATCCTCGACAAAGAACTCAAGGCCGTCTATATGCGCACCCAT
GTCGACACGGCCTACCCTTTCAAGGACAAGACGAAGCGCGTTGTCGAGGATAACATAGCCAAGATGGAGGCCGCT
TATGCAGACATCGTCACTGGAGGCGACGCGGAGCTTGCAAAGAAGGACTTGAGGTCGCATCTGCGGGAGCATGTC
GTCTGGGAGCGCAACACCGTGTGGAGGGACTTGATTGGCATTGAACGCAGAGCAGAAGCTGCCAGACTGGGGCAG
TCCCTACTGGGTCAGGACCAGAGTGTGGCACCGAAGCGCTTGCAGGGTGATGACGGCGACTTGCCCGCGCGCAAG
CAGTTCCGCACCCCGCTGGGCCGCCTGTCACTGCCCGTCTGGCTTGCCAGTGGGTTTATGCTTACGCTGCTCGCC
TCCATCGCAATCTTCTTTGCCCTTCTTTTTGTTCCCATACTGGCGGCGCCGGAGCAGCAAAACTGTTTGGCCTTG
CTCGTGTTCGTCAGCATCCTTTGGGCCACCGAGACGATTCCGCTCTTCGTAACGTCCCTGCTCATTCCCTTCCTA
TCCGTCATCCTGAGAGTTGTTCGTGAGGAAGACCCCGGCAAGCCCCGGGTGCGGCTCGACTCTCCGGAGGCGACA
CACGCCATATTTGCCTCCATGTGGACCCCGGTGATCATGCTATTGCTTGGAGGCTTCACCTTGGCTGCTGCGCTG
TCCAAGTGCACAATCGACAAGCGGCTTGCAACACTCGTCCTGAGCAAGGCCGGCACGCAACCAAAGACTGTCCTC
ATCGCAAACATGGCCGTCGCTGCCTTCGCGTCCATGCTTATCAGCAACGTGGCCGCTCCGGTCCTGTGCTACTCC
ATCATCGAACCAATGTTGCGAACGCTGCCTTCAGACTCCAACATGTCCAAGGCTGTCATCATAGGGATCGCCTTG
GCGTCCAATATTGGTGGCATGCTCTCCCCCATCGCATCACCGCAAAATGTAGTGGCCATGGGCATCATGCAGCCC
GAGCCTACCTGGCTGCAGTGGTTCTTTATCGTTATCCCGGTCGGTGTCGTGTCCATCCTTCTCCTCTGGCTGCTT
CTGCTGGTGTCGTTCCAGCCTGGCAAGGGCACGACGATCGCTCCGATCCGACCCGTGAAGGAGTCGTTCACCGGC
GTTCAGTGGTTTGTCTCGGTCATCACCGTCGTCACTATCGCGCTGTGGTGTGCCAGTCATCAAATGGAGGGCGTC
TTCGGCGACATGGGCGTAATTGCCATTATGCCAGTTGTGCTCTTTTTCGGAATTGGCATACTTACCAAGGAGGAC
TTCAACAACTTCCCCTGGACCATCATCATCCTGGCTGCGGGGGGCTTGTCCCTCGGCAAAGCGGTCAGGTCTTCG
GGTCTACTGCATCTCCTTGCGGAAATGGTGTCGTATAAGGTCCAGGACATGAGCAAATACGGCGTCTTGTTCGTC
TTCTCGGTCCTCATACTGGTCATTGCCACGTTCATCAGCCACACGGTTGCTGCACTTATCTTTCTGCCGCTCGTG
TATGACGTGGGTGCGGCCATGGACCAGCCGCACCCGAATCTACTCGTCATGGGAGGCGTTCTTATGTGCAGTGCG
GCCATGGGACTTCCTACCAGCGGCTTCCCCAACATGACTGCCATTATGAAGGAGGACGCCGCCGGTCAGAGATAT
TTGCGTGTGCAACATTTCATCAGCAGGGGAGTTCCCGGCAGTATTATCACACTCATCGTGGTAATGACTCTCGGC
TACGGCATCATGGAAGTAGCAGGGCTAGACTGA
Gene >Hirsu2|1301
ATGCTCAAGAAGCGCATCACCAGCCTCTACGTCCAGCTGTGCGAGCTCAAGTCCTACGTTCAGCTGAACAAGACG
GGTTTCAGCAAGGTCCTGAAGAAATTTGACAAGATCCTCGACAAAGAACTCAAGGCCGTCTATATGCGCACCCAT
GTCGACACGGCCTACCCTTTCAAGGACAAGACGAAGCGCGTTGTCGAGGATAACATAGCCAAGATGGAGGCCGCT
TATGCAGACATCGTCACTGGAGGCGACGCGGAGCTTGCAAAGAAGGACTTGAGGTCGCATCTGCGGGAGCATGTC
GTCTGGGAGCGCAACACCGTGTGGAGGGACTTGATTGGCATTGAACGCAGAGCAGAAGCTGCCAGACTGGGGCAG
TCCCTACTGGGTCAGGACCAGAGTGTGGCACCGAAGCGCTTGCAGGGTGATGACGGCGACTTGCCCGCGCGCAAG
CAGTTCCGCACCCCGCTGGGCCGCCTGTCACTGCCCGTCTGGCTTGCCAGTGGGTTTATGCTTACGCTGCTCGCC
TCCATCGCAATCTTCTTTGCCCTTCTTTTTGTTCCCATACTGGCGGCGCCGGAGCAGCAAAACTGTTTGGCCTTG
CTCGTGTTCGTCAGCATCCTTTGGGCCACCGAGGTAAGTAGGCTGCCGAACCGATCCAGTGCCGAGCGCTTTCTC
ACCTTCGGAACAGACGATTCCGCTCTTCGTAACGTCCCTGCTCATTCCCTTCCTATCCGTCATCCTGAGAGTTGT
TCGTGAGGAAGACCCCGGCAAGCCCCGGGTGCGGCTCGACTCTCCGGAGGCGACACACGCCATATTTGCCTCCAT
GTGGACCCCGGTGATCATGCTATTGCTTGGAGGCTTCACCTTGGCTGCTGCGCTGTCCAAGTGCACAATCGACAA
GCGGCTTGCAACACTCGTCCTGAGCAAGGCCGGCACGCAACCAAAGACTGTCCTCATCGCAAACATGGCCGTCGC
TGCCTTCGCGTCCATGCTTATCAGCAACGTGGCCGCTCCGGTCCTGTGCTACTCCATCATCGAAGTATGTACTCC
ACGCCACTCCGTGGAAAAACTCTCAGCCTGACGGTACTGTGCAGCCAATGTTGCGAACGCTGCCTTCAGACTCCA
ACATGTCCAAGGCTGTCATCATAGGGATCGCCTTGGCGTCCAATATTGGTGGCATGCTCTCCCCCATCGCATCAC
CGCAAAATGTAGTGGCCATGGGCATCATGCAGCCCGAGCCTACCTGGCTGCAGTGGTTCTTTATCGTTATCCCGG
TCGGTGTCGTGTCCATCCTTCTCCTCTGGCTGCTTCTGCTGGTGTCGTTCCAGCCTGGCAAGGGCACGACGATCG
CTCCGATCCGACCCGTGAAGGAGTCGTTCACCGGCGTTCAGTGGTTTGTCTCGGTCATCACCGTCGTCACTATCG
CGCTGTGGTGTGCCAGTCATCAAATGGAGGGCGTCTTCGGCGACATGGGCGTAATTGCCATTATGCCAGTTGTGC
TCTTTTTCGGAATTGGCATACTTACCAAGGAGGACTTCAACAACTTCCCCTGGACCATCATCATCCTGGCTGCGG
GGGGCTTGTCCCTCGGCAAAGCGGTCAGGTCTTCGGGTCTACTGCATCTCCTTGCGGAAATGGTGTCGTATAAGG
TCCAGGACATGAGCAAATACGGCGTCTTGTTCGTCTTCTCGGTCCTCATACTGGTCATTGCCACGTTCATCAGCC
ACACGGTTGCTGCACTTATCTTTCTGCCGCTCGTGTATGACGTGGGTGCGGCCATGGACCAGCCGCACCCGAATC
TACTCGTCATGGGAGGCGTTCTTATGTGCAGTGCGGCCATGGGACTTCCTACCAGCGGCTTCCCCAACATGAGTA
AGTCGTTGCGGAAAAGAAGACACAGGCTTCTTCTAGGAGCCCTGGAAATTCGAATACAGCTGACGAGCTATAGCT
GCCATTATGAAGGAGGACGCCGCCGGTCAGAGATATTTGCGTGTGCAACATTTCATCAGCAGGGGAGTTCCCGGC
AGTATTATCACACTCATCGTGGTAATGACTCTCGGCTACGGCATCATGGAAGTAGCAGGGCTAGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail