Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|13
Gene name
LocationContig_10:27946..29097
Strand+
Gene length (bp)1151
Transcript length (bp)987
Coding sequence length (bp)987
Protein length (aa) 329

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12063|UPPS_YEAST Dehydrodolichyl diphosphate syntase complex subunit NUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUS1 PE=1 SV=1 56 328 2.0E-52
sp|Q9Y7K8|UPPS_SCHPO Dehydrodolichyl diphosphate syntase complex subunit nus1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nus1 PE=1 SV=1 75 327 5.0E-52
sp|Q99LJ8|NGBR_MOUSE Dehydrodolichyl diphosphate syntase complex subunit Nus1 OS=Mus musculus GN=Nus1 PE=2 SV=1 112 328 1.0E-26
sp|Q96E22|NGBR_HUMAN Dehydrodolichyl diphosphate syntase complex subunit NUS1 OS=Homo sapiens GN=NUS1 PE=1 SV=1 112 328 7.0E-26
sp|Q6DHR8|NGBR_DANRE Dehydrodolichyl diphosphate syntase complex subunit nus1 OS=Danio rerio GN=nus1 PE=2 SV=1 118 328 8.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12063|UPPS_YEAST Dehydrodolichyl diphosphate syntase complex subunit NUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUS1 PE=1 SV=1 56 328 2.0E-52
sp|Q9Y7K8|UPPS_SCHPO Dehydrodolichyl diphosphate syntase complex subunit nus1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nus1 PE=1 SV=1 75 327 5.0E-52
sp|Q99LJ8|NGBR_MOUSE Dehydrodolichyl diphosphate syntase complex subunit Nus1 OS=Mus musculus GN=Nus1 PE=2 SV=1 112 328 1.0E-26
sp|Q96E22|NGBR_HUMAN Dehydrodolichyl diphosphate syntase complex subunit NUS1 OS=Homo sapiens GN=NUS1 PE=1 SV=1 112 328 7.0E-26
sp|Q6DHR8|NGBR_DANRE Dehydrodolichyl diphosphate syntase complex subunit nus1 OS=Danio rerio GN=nus1 PE=2 SV=1 118 328 8.0E-18
sp|Q8A1E0|ISPT_BACTN Isoprenyl transferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=uppS PE=3 SV=1 213 328 4.0E-09
sp|Q8DI29|ISPT_THEEB Isoprenyl transferase OS=Thermosynechococcus elongatus (strain BP-1) GN=uppS PE=3 SV=1 120 328 9.0E-08
sp|Q7MXJ4|ISPT_PORGI Isoprenyl transferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=uppS PE=3 SV=1 216 328 9.0E-08
sp|Q58767|UPPS_METJA Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=uppS PE=3 SV=1 217 328 3.0E-07
sp|Q55482|ISPT_SYNY3 Isoprenyl transferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=uppS PE=3 SV=1 120 328 3.0E-07
sp|Q8PMK9|UPPS_XANAC Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) OS=Xanthomonas axonopodis pv. citri (strain 306) GN=uppS PE=3 SV=1 201 327 4.0E-07
sp|Q5H1E5|UPPS_XANOR Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=uppS PE=3 SV=1 201 327 5.0E-07
sp|O26334|UPPS_METTH Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=uppS PE=3 SV=1 230 327 1.0E-06
sp|Q667J4|UPPS_YERPS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=uppS PE=3 SV=1 217 327 1.0E-06
sp|Q8ZH61|UPPS_YERPE Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) OS=Yersinia pestis GN=uppS PE=3 SV=1 217 327 1.0E-06
sp|P60480|ISPT1_CORDI Isoprenyl transferase 1 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=uppS1 PE=3 SV=1 101 328 2.0E-06
sp|P58563|ISPT1_NOSS1 Isoprenyl transferase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=uppS1 PE=3 SV=1 122 328 6.0E-06
sp|Q7V102|ISPT_PROMP Isoprenyl transferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=uppS PE=3 SV=1 162 327 9.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus 0.2535 0.261 0.1102 0.1064 0.1549 0.0051 0.4939 0.3217 0.5826 0.0454

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 63 85 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1627
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2870
Ophiocordyceps australis map64 (Brazil) OphauB2|2257
Ophiocordyceps camponoti-floridani Ophcf2|05116
Ophiocordyceps camponoti-rufipedis Ophun1|7512
Ophiocordyceps kimflemingae Ophio5|4375
Ophiocordyceps subramaniannii Hirsu2|13 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|13
MPLNARARAVYREDELRNHDFLTEQDRTSLLQANLPAPSEIPTVRRSSTSPSQRRRRLGVRRFLRHQLHVVVFAI
LHGIFSVYIRVRKTYNLVCYQVSSVLYYHHATPEYIRRDVMGLGRRPKHLSALLKAEENQRAKADLERLIDETAE
LATWCACAEIPMLSVYEKTGILKKHIPRVHDAVIQKFTFYFAGHYPSLSVTSPHKDEYSSSTHDQGNQGHLKLHL
ISAEDGRESIVDLTRTLAEMSQKGKLSPRDVSIELVDTELSEGIMPEPDLLLLFGPYPELSGYPPWQIRLTEIFC
LQDNESFGYQVFVKALRKYAKAQMRRGK*
Coding >Hirsu2|13
ATGCCTCTGAACGCGCGCGCCCGCGCCGTCTATCGCGAGGACGAGCTGCGCAACCACGATTTCCTGACGGAGCAA
GACAGGACGAGCCTGCTCCAGGCAAATCTGCCGGCCCCGAGCGAGATACCGACTGTCAGGAGATCGTCTACGTCG
CCGTCGCAGCGCCGCCGCCGGCTGGGCGTCCGGCGCTTCCTCCGACACCAGCTGCACGTCGTCGTCTTCGCCATC
CTGCACGGCATCTTCTCCGTCTACATCCGCGTCCGCAAGACCTACAACCTGGTCTGCTACCAGGTGTCGTCGGTC
CTCTACTACCACCACGCGACGCCCGAGTACATCCGCCGAGACGTCATGGGGCTGGGCCGCCGGCCCAAGCACCTC
AGCGCCCTGCTCAAGGCCGAGGAGAACCAGCGCGCCAAGGCAGACCTGGAACGGCTCATCGACGAGACGGCCGAG
CTCGCCACCTGGTGCGCTTGCGCCGAGATCCCCATGCTCTCCGTGTACGAGAAGACAGGCATCCTGAAGAAACAC
ATTCCCCGAGTCCACGACGCCGTCATCCAGAAGTTCACCTTCTACTTTGCCGGCCACTACCCCAGCCTTTCGGTT
ACGTCGCCGCACAAGGACGAGTACTCGTCGTCCACCCACGATCAGGGCAACCAGGGCCACCTGAAGCTTCACCTC
ATTTCGGCCGAGGACGGCCGCGAGTCCATCGTCGACCTCACCCGGACCCTGGCCGAGATGTCGCAGAAGGGGAAG
CTGTCGCCGCGGGACGTTTCCATCGAGCTGGTCGACACGGAGCTGTCGGAGGGCATCATGCCGGAGCCGGACCTC
CTGCTCCTCTTCGGCCCCTACCCGGAGCTCTCGGGCTACCCGCCCTGGCAGATCCGCCTGACCGAGATCTTCTGC
CTGCAGGACAACGAGAGCTTCGGGTACCAGGTCTTCGTCAAGGCGCTGCGCAAATACGCCAAGGCGCAGATGCGC
CGCGGCAAATGA
Transcript >Hirsu2|13
ATGCCTCTGAACGCGCGCGCCCGCGCCGTCTATCGCGAGGACGAGCTGCGCAACCACGATTTCCTGACGGAGCAA
GACAGGACGAGCCTGCTCCAGGCAAATCTGCCGGCCCCGAGCGAGATACCGACTGTCAGGAGATCGTCTACGTCG
CCGTCGCAGCGCCGCCGCCGGCTGGGCGTCCGGCGCTTCCTCCGACACCAGCTGCACGTCGTCGTCTTCGCCATC
CTGCACGGCATCTTCTCCGTCTACATCCGCGTCCGCAAGACCTACAACCTGGTCTGCTACCAGGTGTCGTCGGTC
CTCTACTACCACCACGCGACGCCCGAGTACATCCGCCGAGACGTCATGGGGCTGGGCCGCCGGCCCAAGCACCTC
AGCGCCCTGCTCAAGGCCGAGGAGAACCAGCGCGCCAAGGCAGACCTGGAACGGCTCATCGACGAGACGGCCGAG
CTCGCCACCTGGTGCGCTTGCGCCGAGATCCCCATGCTCTCCGTGTACGAGAAGACAGGCATCCTGAAGAAACAC
ATTCCCCGAGTCCACGACGCCGTCATCCAGAAGTTCACCTTCTACTTTGCCGGCCACTACCCCAGCCTTTCGGTT
ACGTCGCCGCACAAGGACGAGTACTCGTCGTCCACCCACGATCAGGGCAACCAGGGCCACCTGAAGCTTCACCTC
ATTTCGGCCGAGGACGGCCGCGAGTCCATCGTCGACCTCACCCGGACCCTGGCCGAGATGTCGCAGAAGGGGAAG
CTGTCGCCGCGGGACGTTTCCATCGAGCTGGTCGACACGGAGCTGTCGGAGGGCATCATGCCGGAGCCGGACCTC
CTGCTCCTCTTCGGCCCCTACCCGGAGCTCTCGGGCTACCCGCCCTGGCAGATCCGCCTGACCGAGATCTTCTGC
CTGCAGGACAACGAGAGCTTCGGGTACCAGGTCTTCGTCAAGGCGCTGCGCAAATACGCCAAGGCGCAGATGCGC
CGCGGCAAATGA
Gene >Hirsu2|13
ATGCCTCTGAACGCGCGCGCCCGCGCCGTCTATCGCGAGGACGAGCTGCGCAACCACGATTTCCTGACGGAGCAA
GACAGGACGAGCCTGCTCCAGGTTCGGCGCCCCTGCGGCCACGCGCTCTCCGTCTCGCTCTCTCTCGCCGTCTCC
CGACGCTGACAACACGGCAGGCAAATCTGCCGGCCCCGAGCGAGATACCGACTGTCAGGAGATCGTCTACGTCGC
CGTCGCAGCGCCGCCGCCGGCTGGGCGTCCGGCGCTTCCTCCGACACCAGCTGCACGTCGTCGTCTTCGCCATCC
TGCACGGCATCTTCTCCGTCTACATCCGCGTCCGCAAGACCTACAACCTGGTCTGCTACCAGGTGTCGTCGGTCC
TCTACTACCACCACGCGACGCCCGAGTACATCCGCCGAGACGTCATGGGGCTGGGCCGCCGGCCCAAGCACCTCA
GCGCCCTGCTCAAGGCCGAGGAGAACCAGCGCGCCAAGGCAGACCTGGAACGGCTCATCGACGAGACGGCCGAGC
TCGCCACCTGGTGCGCTTGCGCCGAGATCCCCATGCTCTCCGTGTACGAGAAGACAGGTTCGTCGTCGCCCAAGA
AAAGAAGAGAAAAAAGAAAACCCCCCCGCCGCGACGTGTGACGATTCTTACAAGAGACGGGGAGGGAAACAGGCA
TCCTGAAGAAACACATTCCCCGAGTCCACGACGCCGTCATCCAGAAGTTCACCTTCTACTTTGCCGGCCACTACC
CCAGCCTTTCGGTTACGTCGCCGCACAAGGACGAGTACTCGTCGTCCACCCACGATCAGGGCAACCAGGGCCACC
TGAAGCTTCACCTCATTTCGGCCGAGGACGGCCGCGAGTCCATCGTCGACCTCACCCGGACCCTGGCCGAGATGT
CGCAGAAGGGGAAGCTGTCGCCGCGGGACGTTTCCATCGAGCTGGTCGACACGGAGCTGTCGGAGGGCATCATGC
CGGAGCCGGACCTCCTGCTCCTCTTCGGCCCCTACCCGGAGCTCTCGGGCTACCCGCCCTGGCAGATCCGCCTGA
CCGAGATCTTCTGCCTGCAGGACAACGAGAGCTTCGGGTACCAGGTCTTCGTCAAGGCGCTGCGCAAATACGCCA
AGGCGCAGATGCGCCGCGGCAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail