Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|13
Gene name
LocationContig_10:27946..29097
Strand+
Gene length (bp)1151
Transcript length (bp)987
Coding sequence length (bp)987
Protein length (aa) 329

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01255 Prenyltransf Putative undecaprenyl diphosphate synthase 7.3E-06 185 326

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12063|UPPS_YEAST Dehydrodolichyl diphosphate syntase complex subunit NUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUS1 PE=1 SV=1 56 328 2.0E-52
sp|Q9Y7K8|UPPS_SCHPO Dehydrodolichyl diphosphate syntase complex subunit nus1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nus1 PE=1 SV=1 75 327 5.0E-52
sp|Q99LJ8|NGBR_MOUSE Dehydrodolichyl diphosphate syntase complex subunit Nus1 OS=Mus musculus GN=Nus1 PE=2 SV=1 112 328 1.0E-26
sp|Q96E22|NGBR_HUMAN Dehydrodolichyl diphosphate syntase complex subunit NUS1 OS=Homo sapiens GN=NUS1 PE=1 SV=1 112 328 7.0E-26
sp|Q6DHR8|NGBR_DANRE Dehydrodolichyl diphosphate syntase complex subunit nus1 OS=Danio rerio GN=nus1 PE=2 SV=1 118 328 8.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12063|UPPS_YEAST Dehydrodolichyl diphosphate syntase complex subunit NUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUS1 PE=1 SV=1 56 328 2.0E-52
sp|Q9Y7K8|UPPS_SCHPO Dehydrodolichyl diphosphate syntase complex subunit nus1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nus1 PE=1 SV=1 75 327 5.0E-52
sp|Q99LJ8|NGBR_MOUSE Dehydrodolichyl diphosphate syntase complex subunit Nus1 OS=Mus musculus GN=Nus1 PE=2 SV=1 112 328 1.0E-26
sp|Q96E22|NGBR_HUMAN Dehydrodolichyl diphosphate syntase complex subunit NUS1 OS=Homo sapiens GN=NUS1 PE=1 SV=1 112 328 7.0E-26
sp|Q6DHR8|NGBR_DANRE Dehydrodolichyl diphosphate syntase complex subunit nus1 OS=Danio rerio GN=nus1 PE=2 SV=1 118 328 8.0E-18
sp|Q8A1E0|ISPT_BACTN Isoprenyl transferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=uppS PE=3 SV=1 213 328 4.0E-09
sp|Q8DI29|ISPT_THEEB Isoprenyl transferase OS=Thermosynechococcus elongatus (strain BP-1) GN=uppS PE=3 SV=1 120 328 9.0E-08
sp|Q7MXJ4|ISPT_PORGI Isoprenyl transferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=uppS PE=3 SV=1 216 328 9.0E-08
sp|Q55482|ISPT_SYNY3 Isoprenyl transferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=uppS PE=3 SV=1 120 328 3.0E-07
sp|Q58767|UPPS_METJA Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=uppS PE=3 SV=1 217 328 3.0E-07
sp|Q8PMK9|UPPS_XANAC Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) OS=Xanthomonas axonopodis pv. citri (strain 306) GN=uppS PE=3 SV=1 201 327 4.0E-07
sp|Q5H1E5|UPPS_XANOR Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=uppS PE=3 SV=1 201 327 5.0E-07
sp|O26334|UPPS_METTH Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=uppS PE=3 SV=1 230 327 1.0E-06
sp|Q667J4|UPPS_YERPS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=uppS PE=3 SV=1 217 327 1.0E-06
sp|Q8ZH61|UPPS_YERPE Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) OS=Yersinia pestis GN=uppS PE=3 SV=1 217 327 1.0E-06
sp|P60480|ISPT1_CORDI Isoprenyl transferase 1 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=uppS1 PE=3 SV=1 101 328 2.0E-06
sp|P58563|ISPT1_NOSS1 Isoprenyl transferase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=uppS1 PE=3 SV=1 122 328 6.0E-06
sp|Q7V102|ISPT_PROMP Isoprenyl transferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=uppS PE=3 SV=1 162 327 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|13
MPLNARARAVYREDELRNHDFLTEQDRTSLLQANLPAPSEIPTVRRSSTSPSQRRRRLGVRRFLRHQLHVVVFAI
LHGIFSVYIRVRKTYNLVCYQVSSVLYYHHATPEYIRRDVMGLGRRPKHLSALLKAEENQRAKADLERLIDETAE
LATWCACAEIPMLSVYEKTGILKKHIPRVHDAVIQKFTFYFAGHYPSLSVTSPHKDEYSSSTHDQGNQGHLKLHL
ISAEDGRESIVDLTRTLAEMSQKGKLSPRDVSIELVDTELSEGIMPEPDLLLLFGPYPELSGYPPWQIRLTEIFC
LQDNESFGYQVFVKALRKYAKAQMRRGK*
Coding >Hirsu2|13
ATGCCTCTGAACGCGCGCGCCCGCGCCGTCTATCGCGAGGACGAGCTGCGCAACCACGATTTCCTGACGGAGCAA
GACAGGACGAGCCTGCTCCAGGCAAATCTGCCGGCCCCGAGCGAGATACCGACTGTCAGGAGATCGTCTACGTCG
CCGTCGCAGCGCCGCCGCCGGCTGGGCGTCCGGCGCTTCCTCCGACACCAGCTGCACGTCGTCGTCTTCGCCATC
CTGCACGGCATCTTCTCCGTCTACATCCGCGTCCGCAAGACCTACAACCTGGTCTGCTACCAGGTGTCGTCGGTC
CTCTACTACCACCACGCGACGCCCGAGTACATCCGCCGAGACGTCATGGGGCTGGGCCGCCGGCCCAAGCACCTC
AGCGCCCTGCTCAAGGCCGAGGAGAACCAGCGCGCCAAGGCAGACCTGGAACGGCTCATCGACGAGACGGCCGAG
CTCGCCACCTGGTGCGCTTGCGCCGAGATCCCCATGCTCTCCGTGTACGAGAAGACAGGCATCCTGAAGAAACAC
ATTCCCCGAGTCCACGACGCCGTCATCCAGAAGTTCACCTTCTACTTTGCCGGCCACTACCCCAGCCTTTCGGTT
ACGTCGCCGCACAAGGACGAGTACTCGTCGTCCACCCACGATCAGGGCAACCAGGGCCACCTGAAGCTTCACCTC
ATTTCGGCCGAGGACGGCCGCGAGTCCATCGTCGACCTCACCCGGACCCTGGCCGAGATGTCGCAGAAGGGGAAG
CTGTCGCCGCGGGACGTTTCCATCGAGCTGGTCGACACGGAGCTGTCGGAGGGCATCATGCCGGAGCCGGACCTC
CTGCTCCTCTTCGGCCCCTACCCGGAGCTCTCGGGCTACCCGCCCTGGCAGATCCGCCTGACCGAGATCTTCTGC
CTGCAGGACAACGAGAGCTTCGGGTACCAGGTCTTCGTCAAGGCGCTGCGCAAATACGCCAAGGCGCAGATGCGC
CGCGGCAAATGA
Transcript >Hirsu2|13
ATGCCTCTGAACGCGCGCGCCCGCGCCGTCTATCGCGAGGACGAGCTGCGCAACCACGATTTCCTGACGGAGCAA
GACAGGACGAGCCTGCTCCAGGCAAATCTGCCGGCCCCGAGCGAGATACCGACTGTCAGGAGATCGTCTACGTCG
CCGTCGCAGCGCCGCCGCCGGCTGGGCGTCCGGCGCTTCCTCCGACACCAGCTGCACGTCGTCGTCTTCGCCATC
CTGCACGGCATCTTCTCCGTCTACATCCGCGTCCGCAAGACCTACAACCTGGTCTGCTACCAGGTGTCGTCGGTC
CTCTACTACCACCACGCGACGCCCGAGTACATCCGCCGAGACGTCATGGGGCTGGGCCGCCGGCCCAAGCACCTC
AGCGCCCTGCTCAAGGCCGAGGAGAACCAGCGCGCCAAGGCAGACCTGGAACGGCTCATCGACGAGACGGCCGAG
CTCGCCACCTGGTGCGCTTGCGCCGAGATCCCCATGCTCTCCGTGTACGAGAAGACAGGCATCCTGAAGAAACAC
ATTCCCCGAGTCCACGACGCCGTCATCCAGAAGTTCACCTTCTACTTTGCCGGCCACTACCCCAGCCTTTCGGTT
ACGTCGCCGCACAAGGACGAGTACTCGTCGTCCACCCACGATCAGGGCAACCAGGGCCACCTGAAGCTTCACCTC
ATTTCGGCCGAGGACGGCCGCGAGTCCATCGTCGACCTCACCCGGACCCTGGCCGAGATGTCGCAGAAGGGGAAG
CTGTCGCCGCGGGACGTTTCCATCGAGCTGGTCGACACGGAGCTGTCGGAGGGCATCATGCCGGAGCCGGACCTC
CTGCTCCTCTTCGGCCCCTACCCGGAGCTCTCGGGCTACCCGCCCTGGCAGATCCGCCTGACCGAGATCTTCTGC
CTGCAGGACAACGAGAGCTTCGGGTACCAGGTCTTCGTCAAGGCGCTGCGCAAATACGCCAAGGCGCAGATGCGC
CGCGGCAAATGA
Gene >Hirsu2|13
ATGCCTCTGAACGCGCGCGCCCGCGCCGTCTATCGCGAGGACGAGCTGCGCAACCACGATTTCCTGACGGAGCAA
GACAGGACGAGCCTGCTCCAGGTTCGGCGCCCCTGCGGCCACGCGCTCTCCGTCTCGCTCTCTCTCGCCGTCTCC
CGACGCTGACAACACGGCAGGCAAATCTGCCGGCCCCGAGCGAGATACCGACTGTCAGGAGATCGTCTACGTCGC
CGTCGCAGCGCCGCCGCCGGCTGGGCGTCCGGCGCTTCCTCCGACACCAGCTGCACGTCGTCGTCTTCGCCATCC
TGCACGGCATCTTCTCCGTCTACATCCGCGTCCGCAAGACCTACAACCTGGTCTGCTACCAGGTGTCGTCGGTCC
TCTACTACCACCACGCGACGCCCGAGTACATCCGCCGAGACGTCATGGGGCTGGGCCGCCGGCCCAAGCACCTCA
GCGCCCTGCTCAAGGCCGAGGAGAACCAGCGCGCCAAGGCAGACCTGGAACGGCTCATCGACGAGACGGCCGAGC
TCGCCACCTGGTGCGCTTGCGCCGAGATCCCCATGCTCTCCGTGTACGAGAAGACAGGTTCGTCGTCGCCCAAGA
AAAGAAGAGAAAAAAGAAAACCCCCCCGCCGCGACGTGTGACGATTCTTACAAGAGACGGGGAGGGAAACAGGCA
TCCTGAAGAAACACATTCCCCGAGTCCACGACGCCGTCATCCAGAAGTTCACCTTCTACTTTGCCGGCCACTACC
CCAGCCTTTCGGTTACGTCGCCGCACAAGGACGAGTACTCGTCGTCCACCCACGATCAGGGCAACCAGGGCCACC
TGAAGCTTCACCTCATTTCGGCCGAGGACGGCCGCGAGTCCATCGTCGACCTCACCCGGACCCTGGCCGAGATGT
CGCAGAAGGGGAAGCTGTCGCCGCGGGACGTTTCCATCGAGCTGGTCGACACGGAGCTGTCGGAGGGCATCATGC
CGGAGCCGGACCTCCTGCTCCTCTTCGGCCCCTACCCGGAGCTCTCGGGCTACCCGCCCTGGCAGATCCGCCTGA
CCGAGATCTTCTGCCTGCAGGACAACGAGAGCTTCGGGTACCAGGTCTTCGTCAAGGCGCTGCGCAAATACGCCA
AGGCGCAGATGCGCCGCGGCAAATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail