Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1299
Gene name
LocationContig_1284:6952..7598
Strand-
Gene length (bp)646
Transcript length (bp)507
Coding sequence length (bp)507
Protein length (aa) 169

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region 1.0E-25 11 129
PF14437 MafB19-deam MafB19-like deaminase 1.4E-09 11 132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43012|DCTD_SCHPO Deoxycytidylate deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2G2.13c PE=3 SV=2 1 160 3.0E-73
sp|P06773|DCTD_YEAST Deoxycytidylate deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCD1 PE=1 SV=2 7 153 1.0E-68
sp|O22000|DCTD_BPMD2 Deoxycytidylate deaminase OS=Mycobacterium phage D29 GN=36.1 PE=3 SV=2 8 130 3.0E-23
sp|P32393|COMEB_BACSU ComE operon protein 2 OS=Bacillus subtilis (strain 168) GN=comEB PE=3 SV=1 8 151 1.0E-22
sp|Q5M9G0|DCTD_RAT Deoxycytidylate deaminase OS=Rattus norvegicus GN=Dctd PE=2 SV=1 3 160 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43012|DCTD_SCHPO Deoxycytidylate deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2G2.13c PE=3 SV=2 1 160 3.0E-73
sp|P06773|DCTD_YEAST Deoxycytidylate deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCD1 PE=1 SV=2 7 153 1.0E-68
sp|O22000|DCTD_BPMD2 Deoxycytidylate deaminase OS=Mycobacterium phage D29 GN=36.1 PE=3 SV=2 8 130 3.0E-23
sp|P32393|COMEB_BACSU ComE operon protein 2 OS=Bacillus subtilis (strain 168) GN=comEB PE=3 SV=1 8 151 1.0E-22
sp|Q5M9G0|DCTD_RAT Deoxycytidylate deaminase OS=Rattus norvegicus GN=Dctd PE=2 SV=1 3 160 2.0E-20
sp|Q8K2D6|DCTD_MOUSE Deoxycytidylate deaminase OS=Mus musculus GN=Dctd PE=2 SV=1 3 160 2.0E-20
sp|P32321|DCTD_HUMAN Deoxycytidylate deaminase OS=Homo sapiens GN=DCTD PE=1 SV=2 3 154 9.0E-20
sp|Q5RC69|DCTD_PONAB Deoxycytidylate deaminase OS=Pongo abelii GN=DCTD PE=2 SV=1 3 154 1.0E-19
sp|Q9VWA2|DCTD_DROME Probable deoxycytidylate deaminase OS=Drosophila melanogaster GN=CG6951 PE=2 SV=1 11 128 1.0E-15
sp|P33968|YLXG_ALIFS Uncharacterized deaminase in luxG 3'region OS=Aliivibrio fischeri PE=3 SV=1 11 149 4.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0008251 tRNA-specific adenosine deaminase activity Yes
GO:0002100 tRNA wobble adenosine to inosine editing Yes
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0004000 adenosine deaminase activity No
GO:0044238 primary metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008033 tRNA processing No
GO:0006382 adenosine to inosine editing No
GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines No
GO:0008150 biological_process No
GO:0016553 base conversion or substitution editing No
GO:0046483 heterocycle metabolic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009451 RNA modification No
GO:0034660 ncRNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006400 tRNA modification No
GO:0002097 tRNA wobble base modification No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034470 ncRNA processing No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0090304 nucleic acid metabolic process No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0006399 tRNA metabolic process No
GO:0019239 deaminase activity No
GO:0006396 RNA processing No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1299
LARDDRLRPGWDAYFMALASLAAQRSNCMKRRVGCVLVGRGRRVLSTGYNGTPRGLRNCADGGCPRCNDGHGAGV
GLAACLCIHAEENALLEAGRDRIRDGAVLYCDTCPCLTCSIKICQVGITEVVYSQSYSMDAETAAVFSQAGVTLR
QFTPPPNGLIHLEKMELY*
Coding >Hirsu2|1299
CTGGCGCGCGACGACCGGCTGCGGCCCGGGTGGGACGCCTACTTCATGGCGCTGGCGTCGCTGGCCGCCCAGCGG
TCCAACTGCATGAAGCGCCGCGTCGGCTGCGTCCTGGTCGGCCGCGGCCGCCGCGTCCTCAGCACCGGCTACAAC
GGCACGCCGCGCGGCCTGCGCAACTGCGCCGACGGCGGCTGCCCGCGCTGCAACGACGGCCACGGCGCCGGCGTC
GGCCTCGCCGCCTGCCTGTGCATCCACGCCGAGGAGAACGCGCTGCTCGAGGCCGGCCGCGACCGCATCCGTGAC
GGCGCCGTCCTCTACTGCGACACCTGCCCCTGCCTGACCTGCAGCATCAAGATCTGCCAGGTCGGCATCACCGAG
GTCGTCTACTCCCAGAGCTACAGCATGGACGCCGAGACGGCGGCTGTCTTCAGCCAGGCCGGCGTCACCCTGCGC
CAGTTCACCCCGCCGCCCAATGGGTTGATTCATCTGGAGAAAATGGAGCTGTACTGA
Transcript >Hirsu2|1299
CTGGCGCGCGACGACCGGCTGCGGCCCGGGTGGGACGCCTACTTCATGGCGCTGGCGTCGCTGGCCGCCCAGCGG
TCCAACTGCATGAAGCGCCGCGTCGGCTGCGTCCTGGTCGGCCGCGGCCGCCGCGTCCTCAGCACCGGCTACAAC
GGCACGCCGCGCGGCCTGCGCAACTGCGCCGACGGCGGCTGCCCGCGCTGCAACGACGGCCACGGCGCCGGCGTC
GGCCTCGCCGCCTGCCTGTGCATCCACGCCGAGGAGAACGCGCTGCTCGAGGCCGGCCGCGACCGCATCCGTGAC
GGCGCCGTCCTCTACTGCGACACCTGCCCCTGCCTGACCTGCAGCATCAAGATCTGCCAGGTCGGCATCACCGAG
GTCGTCTACTCCCAGAGCTACAGCATGGACGCCGAGACGGCGGCTGTCTTCAGCCAGGCCGGCGTCACCCTGCGC
CAGTTCACCCCGCCGCCCAATGGGTTGATTCATCTGGAGAAAATGGAGCTGTACTGA
Gene >Hirsu2|1299
CTGGCGCGCGACGACCGGCTGCGGCCCGGGTGGGACGCCTACTTCATGGCGCTGGCGTCGCTGGCCGCCCAGCGG
TCCAACTGCATGAAGCGCCGCGTCGGCTGCGTCCTGGTCGGCCGCGGCCGCCGCGTCCTCAGCACCGGCTACAAC
GGCACGCCGCGCGGCCTGCGCAACTGCGCCGACGGCGGCTGCCCGCGCTGCAACGACGGCCACGGCGCCGGCGTC
GGCCTCGCCGCCTGCCTGTGCATCCACGCCGAGGAGAACGCGCTGCTCGAGGCCGGCCGCGACCGCATCCGTGAC
GGCGCCGTCCTCTACTGCGACACCTGCCCCTGCCTGACCTGCAGCATCAAGATCTGCCAGGTCGGCATCACCGAG
GTCGTCTACTCCCAGAGCTACAGCATGGACGCCGAGACGGCGGCTGTCTTCAGCCAGGCCGGCGTCACCCTGCGC
CAGTTCACCCCGGTACGTCGGCCGCCGGCGTCTACAAGCCGCGCGCCCTCTCCCACACGCACACACCCTCTCCCT
TTTCCCCCTTCTCTCTCTCTTCGCCGCCACGCGCCCCCCCCTTGGGGGCCGACCATGTGCTGATTCGCCATCGTA
GCCGCCCAATGGGTTGATTCATCTGGAGAAAATGGAGCTGTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail