Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1298
Gene name
LocationContig_1284:19..3540
Strand-
Gene length (bp)3521
Transcript length (bp)3204
Coding sequence length (bp)3204
Protein length (aa) 1068

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.8E-39 745 1023
PF07714 Pkinase_Tyr Protein tyrosine kinase 6.1E-23 706 915

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07527|WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wee1 PE=1 SV=1 699 1047 2.0E-72
sp|P32944|SWE1_YEAST Mitosis inhibitor protein kinase SWE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWE1 PE=1 SV=1 696 1048 4.0E-58
sp|Q5AP97|SWE1_CANAL Mitosis inhibitor protein kinase SWE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWE1 PE=1 SV=1 550 942 4.0E-51
sp|P30290|MIK1_SCHPO Mitosis inhibitor protein kinase mik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mik1 PE=3 SV=1 694 1043 2.0E-46
sp|Q91618|PMYT1_XENLA Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Xenopus laevis GN=pkmyt1 PE=1 SV=1 684 935 2.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07527|WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wee1 PE=1 SV=1 699 1047 2.0E-72
sp|P32944|SWE1_YEAST Mitosis inhibitor protein kinase SWE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWE1 PE=1 SV=1 696 1048 4.0E-58
sp|Q5AP97|SWE1_CANAL Mitosis inhibitor protein kinase SWE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWE1 PE=1 SV=1 550 942 4.0E-51
sp|P30290|MIK1_SCHPO Mitosis inhibitor protein kinase mik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mik1 PE=3 SV=1 694 1043 2.0E-46
sp|Q91618|PMYT1_XENLA Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Xenopus laevis GN=pkmyt1 PE=1 SV=1 684 935 2.0E-37
sp|Q9NI63|PMYT1_DROME Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Drosophila melanogaster GN=Myt1 PE=1 SV=2 684 937 2.0E-36
sp|Q54E34|Y6398_DICDI Probable protein kinase DDB_G0291842 OS=Dictyostelium discoideum GN=DDB_G0291842 PE=3 SV=1 698 935 2.0E-36
sp|Q54F40|Y1133_DICDI Probable protein kinase DDB_G0291133 OS=Dictyostelium discoideum GN=DDB_G0291133 PE=3 SV=1 698 932 1.0E-35
sp|Q9ESG9|PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus GN=Pkmyt1 PE=2 SV=3 696 935 4.0E-35
sp|Q99640|PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens GN=PKMYT1 PE=1 SV=1 696 935 7.0E-35
sp|Q6Z829|WEE1_ORYSJ Wee1-like protein kinase OS=Oryza sativa subsp. japonica GN=WEE1 PE=3 SV=1 662 939 2.0E-32
sp|D2HHP1|WEE2_AILME Wee1-like protein kinase 2 OS=Ailuropoda melanoleuca GN=WEE2 PE=3 SV=1 695 939 6.0E-32
sp|A4PES0|WEE2_PIG Wee1-like protein kinase 2 OS=Sus scrofa GN=WEE2 PE=1 SV=2 695 939 1.0E-31
sp|Q66JT0|WEE2_MOUSE Wee1-like protein kinase 2 OS=Mus musculus GN=Wee2 PE=1 SV=2 678 938 2.0E-31
sp|P0C1S8|WEE2_HUMAN Wee1-like protein kinase 2 OS=Homo sapiens GN=WEE2 PE=2 SV=2 695 1006 3.0E-31
sp|E2RSS3|WEE2_CANLF Wee1-like protein kinase 2 OS=Canis lupus familiaris GN=WEE2 PE=3 SV=1 695 939 8.0E-31
sp|E1BTE1|WEE2_CHICK Wee1-like protein kinase 2 OS=Gallus gallus GN=WEE2 PE=3 SV=1 696 939 1.0E-29
sp|Q1LX51|WEE2_DANRE Wee1-like protein kinase 2 OS=Danio rerio GN=wee2 PE=2 SV=2 701 939 2.0E-29
sp|A4QNA8|WEE2_XENTR Wee1-like protein kinase 2 OS=Xenopus tropicalis GN=wee2 PE=2 SV=1 702 939 5.0E-28
sp|P47810|WEE1_MOUSE Wee1-like protein kinase OS=Mus musculus GN=Wee1 PE=1 SV=2 702 951 9.0E-27
sp|Q8QGV2|WEE1B_XENLA Wee1-like protein kinase 1-B OS=Xenopus laevis GN=wee1-b PE=1 SV=1 637 941 2.0E-26
sp|P47817|WEE2A_XENLA Wee1-like protein kinase 2-A OS=Xenopus laevis GN=wee2-a PE=1 SV=2 702 941 3.0E-26
sp|P30291|WEE1_HUMAN Wee1-like protein kinase OS=Homo sapiens GN=WEE1 PE=1 SV=2 690 941 4.0E-26
sp|Q63802|WEE1_RAT Wee1-like protein kinase OS=Rattus norvegicus GN=Wee1 PE=1 SV=1 702 941 5.0E-26
sp|Q8AYK6|WEE1A_XENLA Wee1-like protein kinase 1-A OS=Xenopus laevis GN=wee1-a PE=2 SV=1 634 941 9.0E-26
sp|Q6DFE0|WEE2C_XENLA Wee1-like protein kinase 2-C OS=Xenopus laevis GN=wee2-c PE=2 SV=1 696 939 1.0E-25
sp|O57473|WEE2B_XENLA Wee1-like protein kinase 2-B OS=Xenopus laevis GN=wee2-b PE=1 SV=1 696 939 1.0E-25
sp|Q626B1|PMY13_CAEBR Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis briggsae GN=wee-1.3 PE=3 SV=1 714 937 8.0E-25
sp|O18209|PMY13_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis elegans GN=wee-1.3 PE=1 SV=1 662 935 1.0E-24
sp|Q03963|E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus GN=Eif2ak2 PE=1 SV=2 696 936 2.0E-21
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 703 915 3.0E-21
sp|P54350|WEE1_DROME Wee1-like protein kinase OS=Drosophila melanogaster GN=Wee1 PE=1 SV=2 695 942 2.0E-20
sp|Q63184|E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus GN=Eif2ak2 PE=1 SV=1 696 913 3.0E-19
sp|Q8L4H0|WEE1_ARATH Wee1-like protein kinase OS=Arabidopsis thaliana GN=WEE1 PE=1 SV=1 694 939 4.0E-19
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 700 941 1.0E-18
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 748 958 1.0E-18
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 702 915 2.0E-18
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 702 913 3.0E-18
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 709 913 6.0E-18
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 674 939 1.0E-17
sp|Q20085|PMY11_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.1 OS=Caenorhabditis elegans GN=wee-1.1 PE=2 SV=2 723 937 2.0E-17
sp|P32491|MKK2_YEAST MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK2 PE=1 SV=2 737 916 2.0E-17
sp|Q54ZN3|Y0004_DICDI Probable protein kinase DDB_G0277539 OS=Dictyostelium discoideum GN=DDB_G0277539 PE=3 SV=1 698 861 3.0E-17
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 663 910 3.0E-17
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 766 938 3.0E-17
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 697 913 5.0E-17
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 703 917 6.0E-17
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 746 913 6.0E-17
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 765 913 6.0E-17
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 765 913 7.0E-17
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 695 915 8.0E-17
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 702 927 8.0E-17
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 760 913 2.0E-16
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 747 915 2.0E-16
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 765 913 2.0E-16
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 700 938 2.0E-16
sp|P83100|MK14C_DROME Putative mitogen-activated protein kinase 14C OS=Drosophila melanogaster GN=p38c PE=2 SV=1 713 920 2.0E-16
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 747 910 2.0E-16
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 699 915 2.0E-16
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 740 910 2.0E-16
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 746 913 2.0E-16
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 659 930 2.0E-16
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 702 917 2.0E-16
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 693 915 3.0E-16
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 701 938 3.0E-16
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 702 914 4.0E-16
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 699 913 4.0E-16
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 703 915 4.0E-16
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 703 915 4.0E-16
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 703 915 5.0E-16
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 707 938 6.0E-16
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 708 938 6.0E-16
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 741 913 7.0E-16
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 687 913 7.0E-16
sp|Q9M1Z9|LRK58_ARATH Putative L-type lectin-domain containing receptor kinase V.8 OS=Arabidopsis thaliana GN=LECRK58 PE=3 SV=1 703 916 7.0E-16
sp|Q0CLX3|ATG1_ASPTN Serine/threonine-protein kinase atg1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg1 PE=3 SV=1 702 913 7.0E-16
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 703 914 7.0E-16
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 702 915 7.0E-16
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 703 915 8.0E-16
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 766 938 8.0E-16
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 703 915 8.0E-16
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 765 913 8.0E-16
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 674 913 8.0E-16
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 703 915 8.0E-16
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 703 915 8.0E-16
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 703 915 8.0E-16
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 703 915 8.0E-16
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 709 913 9.0E-16
sp|P38973|CC2H1_TRYBB Cell division control protein 2 homolog 1 OS=Trypanosoma brucei brucei GN=CRK1 PE=3 SV=1 701 1024 9.0E-16
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 703 915 1.0E-15
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 741 913 1.0E-15
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 703 915 1.0E-15
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 702 914 1.0E-15
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 703 915 1.0E-15
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 703 915 1.0E-15
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 702 913 1.0E-15
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 702 917 2.0E-15
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 702 914 2.0E-15
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 702 916 2.0E-15
sp|Q9H4A3|WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens GN=WNK1 PE=1 SV=2 652 917 2.0E-15
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 702 916 2.0E-15
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 701 916 2.0E-15
sp|O04534|LRK51_ARATH Putative L-type lectin-domain containing receptor kinase V.1 OS=Arabidopsis thaliana GN=LECRK51 PE=3 SV=1 703 916 2.0E-15
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 701 916 3.0E-15
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 697 913 3.0E-15
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 703 913 3.0E-15
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 703 916 3.0E-15
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 701 916 4.0E-15
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 770 938 4.0E-15
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 703 925 4.0E-15
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 703 914 4.0E-15
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 703 915 4.0E-15
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 703 916 4.0E-15
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 701 948 4.0E-15
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 690 916 4.0E-15
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 703 915 4.0E-15
sp|P19525|E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens GN=EIF2AK2 PE=1 SV=2 703 913 4.0E-15
sp|Q96285|LRK55_ARATH L-type lectin-domain containing receptor kinase V.5 OS=Arabidopsis thaliana GN=LECRK55 PE=1 SV=1 703 916 5.0E-15
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 765 913 5.0E-15
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 771 936 5.0E-15
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 741 913 5.0E-15
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 703 915 5.0E-15
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 703 915 6.0E-15
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 766 938 6.0E-15
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 702 916 7.0E-15
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 741 913 7.0E-15
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 701 918 7.0E-15
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 664 913 8.0E-15
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 707 916 8.0E-15
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 703 915 8.0E-15
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 722 913 9.0E-15
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 741 913 9.0E-15
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 709 913 9.0E-15
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 664 913 9.0E-15
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 769 913 9.0E-15
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 726 931 9.0E-15
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 703 916 1.0E-14
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 771 913 1.0E-14
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 666 915 1.0E-14
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 702 917 1.0E-14
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 702 913 1.0E-14
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 719 915 1.0E-14
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 702 927 1.0E-14
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 664 913 1.0E-14
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 719 915 1.0E-14
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 703 915 1.0E-14
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 766 911 1.0E-14
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 719 915 1.0E-14
sp|Q9JIH7|WNK1_RAT Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus GN=Wnk1 PE=1 SV=2 700 915 1.0E-14
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 676 913 2.0E-14
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 701 916 2.0E-14
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 698 918 2.0E-14
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 703 910 2.0E-14
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 703 910 2.0E-14
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 765 913 2.0E-14
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 740 913 2.0E-14
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 719 915 2.0E-14
sp|P83741|WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus GN=Wnk1 PE=1 SV=2 689 915 2.0E-14
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 703 915 2.0E-14
sp|P20794|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2 740 913 2.0E-14
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 766 911 2.0E-14
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 709 913 2.0E-14
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 698 918 2.0E-14
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 703 915 2.0E-14
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 702 913 3.0E-14
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 770 910 3.0E-14
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 709 913 3.0E-14
sp|Q23915|KINX_DICDI Probable serine/threonine-protein kinase kinX OS=Dictyostelium discoideum GN=kinX PE=3 SV=2 700 918 3.0E-14
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 702 914 3.0E-14
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 719 913 3.0E-14
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 676 910 3.0E-14
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 664 913 3.0E-14
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 702 917 3.0E-14
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 702 916 3.0E-14
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 702 915 4.0E-14
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 687 916 4.0E-14
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 667 915 4.0E-14
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 667 915 4.0E-14
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 667 915 4.0E-14
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 709 913 4.0E-14
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 709 939 4.0E-14
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 701 916 4.0E-14
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 703 913 4.0E-14
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 702 913 4.0E-14
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 729 915 5.0E-14
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 703 914 5.0E-14
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 703 916 5.0E-14
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 703 915 5.0E-14
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 703 913 5.0E-14
sp|P20793|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2 740 913 5.0E-14
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 703 913 5.0E-14
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 701 916 5.0E-14
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 702 916 5.0E-14
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 703 915 6.0E-14
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 698 918 6.0E-14
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 703 914 6.0E-14
sp|Q54DC8|Y2350_DICDI Probable serine/threonine-protein kinase DDB_G0292350 OS=Dictyostelium discoideum GN=DDB_G0292350 PE=3 SV=1 771 919 6.0E-14
sp|Q8FUI4|PKN2_COREF Serine/threonine-protein kinases drp72 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0034 PE=3 SV=1 780 913 6.0E-14
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 703 915 6.0E-14
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 703 915 7.0E-14
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 702 915 7.0E-14
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 701 916 7.0E-14
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 707 913 7.0E-14
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 702 915 7.0E-14
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 703 913 7.0E-14
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 703 914 8.0E-14
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 770 912 8.0E-14
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 688 915 8.0E-14
sp|P54199|MPS1_YEAST Serine/threonine-protein kinase MPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPS1 PE=1 SV=2 701 913 8.0E-14
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 747 913 9.0E-14
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 747 913 9.0E-14
sp|O14328|KSP1_SCHPO Serine/threonine-protein kinase ksp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksp1 PE=1 SV=1 737 927 1.0E-13
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 703 913 1.0E-13
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 765 913 1.0E-13
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 723 915 1.0E-13
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 703 936 1.0E-13
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 677 915 1.0E-13
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 702 915 1.0E-13
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 702 915 1.0E-13
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 702 916 1.0E-13
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 709 915 1.0E-13
sp|Q9KIG4|PK1_STRTO Serine/threonine-protein kinase PK-1 OS=Streptomyces toyocaensis GN=spk1 PE=1 SV=1 769 913 1.0E-13
sp|Q696W0|SPEG_DANRE Striated muscle preferentially expressed protein kinase OS=Danio rerio GN=speg PE=2 SV=1 769 911 1.0E-13
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 702 915 1.0E-13
sp|Q6AXJ9|CDKL1_DANRE Cyclin-dependent kinase-like 1 OS=Danio rerio GN=cdkl1 PE=2 SV=1 702 927 1.0E-13
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 740 915 1.0E-13
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 705 915 1.0E-13
sp|Q3UTQ8|CDKL5_MOUSE Cyclin-dependent kinase-like 5 OS=Mus musculus GN=Cdkl5 PE=1 SV=1 693 915 1.0E-13
sp|Q9Y884|SKH1_SCHPO MAP kinase kinase skh1/pek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skh1 PE=3 SV=1 769 917 2.0E-13
sp|O14132|PIT1_SCHPO Sporulation protein kinase pit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pit1 PE=1 SV=1 703 1029 2.0E-13
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 702 916 2.0E-13
sp|P9WI83|PKNA_MYCTU Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknA PE=1 SV=1 798 917 2.0E-13
sp|P9WI82|PKNA_MYCTO Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknA PE=3 SV=1 798 917 2.0E-13
sp|A5TY85|PKNA_MYCTA Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pknA PE=1 SV=1 798 917 2.0E-13
sp|P65727|PKNA_MYCBO Serine/threonine-protein kinase PknA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknA PE=3 SV=1 798 917 2.0E-13
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 703 915 2.0E-13
sp|O76039|CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens GN=CDKL5 PE=1 SV=1 693 913 2.0E-13
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 702 915 2.0E-13
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 703 936 2.0E-13
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 689 913 2.0E-13
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 702 916 2.0E-13
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 703 913 2.0E-13
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 703 913 2.0E-13
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 702 916 2.0E-13
sp|Q9VWQ2|S6KL_DROME Serine/threonine-protein kinase S6KL OS=Drosophila melanogaster GN=S6KL PE=1 SV=1 709 913 2.0E-13
sp|Q54QB1|ERK2_DICDI Extracellular signal-regulated kinase 2 OS=Dictyostelium discoideum GN=erkB PE=1 SV=1 694 976 3.0E-13
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 703 916 3.0E-13
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 703 913 3.0E-13
sp|D7SFH9|GPDL2_ARATH Glycerophosphodiester phosphodiesterase protein kinase domain-containing GDPDL2 OS=Arabidopsis thaliana GN=GDPDL2 PE=1 SV=1 700 913 3.0E-13
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 703 915 3.0E-13
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 696 911 3.0E-13
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 702 917 3.0E-13
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 702 915 3.0E-13
sp|O61443|MK14B_DROME Mitogen-activated protein kinase 14B OS=Drosophila melanogaster GN=p38b PE=1 SV=1 740 913 3.0E-13
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 703 913 3.0E-13
sp|P54743|PKNA_MYCLE Serine/threonine-protein kinase PknA OS=Mycobacterium leprae (strain TN) GN=pknA PE=3 SV=3 798 917 3.0E-13
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 703 913 3.0E-13
sp|X5M5N0|WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans GN=wnk-1 PE=1 SV=1 700 913 4.0E-13
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 703 916 4.0E-13
sp|P50750|CDK9_HUMAN Cyclin-dependent kinase 9 OS=Homo sapiens GN=CDK9 PE=1 SV=3 701 913 4.0E-13
sp|G5ECH7|CDK5_CAEEL Cyclin-dependent-like kinase 5 OS=Caenorhabditis elegans GN=cdk-5 PE=1 SV=1 703 915 4.0E-13
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 701 938 4.0E-13
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 703 913 4.0E-13
sp|P54665|CC2H2_TRYBB Cell division control protein 2 homolog 2 OS=Trypanosoma brucei brucei GN=CRK2 PE=3 SV=1 702 915 4.0E-13
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 765 917 4.0E-13
sp|Q17446|PMK1_CAEEL Mitogen-activated protein kinase pmk-1 OS=Caenorhabditis elegans GN=pmk-1 PE=1 SV=1 727 913 4.0E-13
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 703 913 4.0E-13
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 690 910 4.0E-13
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 703 913 5.0E-13
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 770 915 5.0E-13
sp|O04533|LRK52_ARATH Putative L-type lectin-domain containing receptor kinase V.2 OS=Arabidopsis thaliana GN=LECRK52 PE=3 SV=1 722 916 5.0E-13
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 686 911 5.0E-13
sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 701 941 5.0E-13
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 703 916 5.0E-13
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 770 910 5.0E-13
sp|P48734|CDK1_BOVIN Cyclin-dependent kinase 1 OS=Bos taurus GN=CDK1 PE=2 SV=2 703 915 5.0E-13
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 576 913 5.0E-13
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 702 913 5.0E-13
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 702 916 5.0E-13
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 686 911 5.0E-13
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 703 913 6.0E-13
sp|P54736|PKN2_MYXXA Serine/threonine-protein kinase pkn2 OS=Myxococcus xanthus GN=pkn2 PE=3 SV=1 747 925 6.0E-13
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 700 920 6.0E-13
sp|A2QN07|MPKC_ASPNC Mitogen-activated protein kinase mpkC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mpkC PE=3 SV=1 708 913 6.0E-13
sp|Q9GT24|ZYG1_CAEEL Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis elegans GN=zyg-1 PE=1 SV=1 703 917 6.0E-13
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 693 930 7.0E-13
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 702 913 7.0E-13
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 708 913 7.0E-13
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 698 938 7.0E-13
sp|Q8SQU8|YBC9_ENCCU Probable cell division protein kinase ECU11_1290 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1290 PE=3 SV=2 688 913 8.0E-13
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 702 916 8.0E-13
sp|P47812|MK14_XENLA Mitogen-activated protein kinase 14 OS=Xenopus laevis GN=mapk14 PE=2 SV=1 732 913 8.0E-13
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 703 913 8.0E-13
sp|E1BB52|CDK13_BOVIN Cyclin-dependent kinase 13 OS=Bos taurus GN=CDK13 PE=3 SV=1 692 913 9.0E-13
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 702 916 9.0E-13
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 702 920 9.0E-13
sp|Q9HG11|MPKC_EMENI Mitogen-activated protein kinase mpkC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpkC PE=2 SV=2 701 913 9.0E-13
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 707 913 9.0E-13
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 702 915 1.0E-12
sp|Q14004|CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens GN=CDK13 PE=1 SV=2 692 913 1.0E-12
sp|Q9ZR79|LRK57_ARATH L-type lectin-domain containing receptor kinase V.7 OS=Arabidopsis thaliana GN=LECRK57 PE=2 SV=2 703 916 1.0E-12
sp|Q5RCH1|CDK1_PONAB Cyclin-dependent kinase 1 OS=Pongo abelii GN=CDK1 PE=2 SV=1 703 915 1.0E-12
sp|O43077|MDE3_SCHPO Sporulation protein kinase mde3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde3 PE=3 SV=1 707 916 1.0E-12
sp|A1CAF0|MPKC_ASPCL Mitogen-activated protein kinase mpkC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mpkC PE=3 SV=1 701 913 1.0E-12
sp|Q40353|MMK2_MEDSA Mitogen-activated protein kinase homolog MMK2 OS=Medicago sativa GN=MMK2 PE=2 SV=1 745 915 1.0E-12
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 680 913 1.0E-12
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 705 915 1.0E-12
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 703 913 1.0E-12
sp|Q9LFT8|CDKC1_ARATH Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana GN=CDKC-1 PE=1 SV=1 703 921 1.0E-12
sp|A1CPG7|HOG1_ASPCL Mitogen-activated protein kinase hog1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hog1 PE=3 SV=1 708 913 1.0E-12
sp|P39951|CDK1_RAT Cyclin-dependent kinase 1 OS=Rattus norvegicus GN=Cdk1 PE=1 SV=1 705 915 1.0E-12
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 703 913 1.0E-12
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 703 913 1.0E-12
sp|Q1KTF2|HOG1_ZYMTI Mitogen-activated protein kinase Hog1 OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) GN=Hog1 PE=3 SV=2 708 913 1.0E-12
sp|O62618|MK14A_DROME Mitogen-activated protein kinase 14A OS=Drosophila melanogaster GN=Mpk2 PE=1 SV=1 732 913 1.0E-12
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 705 915 1.0E-12
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 703 936 1.0E-12
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 703 913 1.0E-12
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 690 910 1.0E-12
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 702 914 1.0E-12
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 693 910 1.0E-12
sp|Q641Z4|CDK9_RAT Cyclin-dependent kinase 9 OS=Rattus norvegicus GN=Cdk9 PE=2 SV=1 702 913 1.0E-12
sp|Q99J95|CDK9_MOUSE Cyclin-dependent kinase 9 OS=Mus musculus GN=Cdk9 PE=1 SV=1 702 913 1.0E-12
sp|Q9LMT0|CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana GN=CDKD-3 PE=1 SV=1 702 913 1.0E-12
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 705 915 1.0E-12
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 702 915 1.0E-12
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 695 931 1.0E-12
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 695 931 1.0E-12
sp|Q5EAB2|CDK9_BOVIN Cyclin-dependent kinase 9 OS=Bos taurus GN=CDK9 PE=2 SV=1 702 913 1.0E-12
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 705 915 1.0E-12
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 782 913 2.0E-12
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 703 913 2.0E-12
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 689 915 2.0E-12
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 702 916 2.0E-12
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 702 915 2.0E-12
sp|A1DES4|MPKC_NEOFI Mitogen-activated protein kinase mpkC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mpkc PE=3 SV=2 701 913 2.0E-12
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 690 910 2.0E-12
sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus GN=Mylk PE=1 SV=2 684 943 2.0E-12
sp|Q8NU97|PKN2_CORGL Serine/threonine-protein kinases PknA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknA PE=3 SV=1 781 917 2.0E-12
sp|Q07176|MMK1_MEDSA Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1 751 1023 2.0E-12
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 703 913 2.0E-12
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 703 916 2.0E-12
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 724 916 2.0E-12
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 703 910 2.0E-12
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 707 915 2.0E-12
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 770 910 2.0E-12
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 709 913 2.0E-12
sp|O22833|LRK54_ARATH L-type lectin-domain containing receptor kinase V.4 OS=Arabidopsis thaliana GN=LECRK54 PE=2 SV=1 707 916 2.0E-12
sp|O44408|KGB1_CAEEL GLH-binding kinase 1 OS=Caenorhabditis elegans GN=kgb-1 PE=1 SV=2 719 932 2.0E-12
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 690 910 2.0E-12
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 702 916 2.0E-12
sp|Q9SZD5|LRK59_ARATH L-type lectin-domain containing receptor kinase V.9 OS=Arabidopsis thaliana GN=LECRK59 PE=2 SV=1 703 916 2.0E-12
sp|Q966Y3|JNK_SUBDO Stress-activated protein kinase JNK OS=Suberites domuncula GN=JNK PE=2 SV=1 707 921 2.0E-12
sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 686 911 2.0E-12
sp|Q8NJT7|HOG1_HORWE Mitogen-activated protein kinase HOG1 OS=Hortaea werneckii GN=HOG1 PE=3 SV=1 708 913 2.0E-12
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 703 916 2.0E-12
sp|Q06309|CRK1_LEIME Cell division protein kinase 2 homolog CRK1 OS=Leishmania mexicana GN=CRK1 PE=2 SV=1 701 915 2.0E-12
sp|Q4WSF6|HOG1_ASPFU Mitogen-activated protein kinase hog1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hog1 PE=1 SV=1 708 913 2.0E-12
sp|P62205|PLK1_XENTR Serine/threonine-protein kinase PLK1 OS=Xenopus tropicalis GN=plk1 PE=2 SV=1 709 910 3.0E-12
sp|Q5A6T5|STE7_CANAL Serine/threonine-protein kinase STE7 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST7 PE=3 SV=1 769 927 3.0E-12
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 708 941 3.0E-12
sp|A1D2C9|HOG1_NEOFI Mitogen-activated protein kinase hog1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hog1 PE=3 SV=1 708 913 3.0E-12
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 747 915 3.0E-12
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 631 918 3.0E-12
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 740 915 3.0E-12
sp|B5DE93|CDK12_XENTR Cyclin-dependent kinase 12 OS=Xenopus tropicalis GN=cdk12 PE=2 SV=1 702 913 3.0E-12
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 691 913 3.0E-12
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 703 913 3.0E-12
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 705 915 3.0E-12
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 765 913 3.0E-12
sp|Q336M2|CDKE1_ORYSJ Cyclin-dependent kinase E-1 OS=Oryza sativa subsp. japonica GN=CDKE-1 PE=2 SV=2 687 913 3.0E-12
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 702 916 3.0E-12
sp|Q9WTU6|MK09_MOUSE Mitogen-activated protein kinase 9 OS=Mus musculus GN=Mapk9 PE=1 SV=2 708 920 3.0E-12
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 719 916 4.0E-12
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 701 913 4.0E-12
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 784 913 4.0E-12
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 784 913 4.0E-12
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 703 915 4.0E-12
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 701 913 4.0E-12
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 703 915 4.0E-12
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 781 915 4.0E-12
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 784 913 4.0E-12
sp|M1T7M3|HOG1B_WALI9 Mitogen-activated protein kinase HOG1B OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1B PE=1 SV=1 709 913 4.0E-12
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 705 915 4.0E-12
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 703 915 4.0E-12
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 763 918 4.0E-12
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 742 916 4.0E-12
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 770 913 4.0E-12
sp|Q6BM25|SSN3_DEBHA Serine/threonine-protein kinase SSN3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SSN3 PE=3 SV=2 698 913 5.0E-12
sp|Q9WUI1|MK11_MOUSE Mitogen-activated protein kinase 11 OS=Mus musculus GN=Mapk11 PE=1 SV=2 748 913 5.0E-12
sp|Q54U31|SHKD_DICDI Dual specificity protein kinase shkD OS=Dictyostelium discoideum GN=shkD PE=3 SV=1 702 913 5.0E-12
sp|P45984|MK09_HUMAN Mitogen-activated protein kinase 9 OS=Homo sapiens GN=MAPK9 PE=1 SV=2 696 920 5.0E-12
sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1 751 913 5.0E-12
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 774 913 5.0E-12
sp|Q8SR90|Y8H9_ENCCU Probable cell division protein kinase ECU11_1290 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1790 PE=3 SV=1 702 913 5.0E-12
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 747 913 5.0E-12
sp|Q6C7U8|PHO85_YARLI Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 701 913 5.0E-12
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 693 910 5.0E-12
sp|Q1DN93|ATG1_COCIM Serine/threonine-protein kinase ATG1 OS=Coccidioides immitis (strain RS) GN=ATG1 PE=3 SV=1 694 913 5.0E-12
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 740 915 5.0E-12
sp|Q9P2K8|E2AK4_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Homo sapiens GN=EIF2AK4 PE=1 SV=3 796 915 5.0E-12
sp|Q8W4P1|CDKC2_ARATH Cyclin-dependent kinase C-2 OS=Arabidopsis thaliana GN=CDKC-2 PE=1 SV=2 703 913 5.0E-12
sp|Q24324|DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 OS=Drosophila melanogaster GN=Dsor1 PE=1 SV=2 732 918 6.0E-12
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 629 913 6.0E-12
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 702 914 6.0E-12
sp|P0CY25|STE7_CANAX Serine/threonine-protein kinase STE7 homolog OS=Candida albicans GN=STE7 PE=3 SV=1 769 927 6.0E-12
sp|C4YLK8|STE7_CANAW Serine/threonine-protein kinase STE7 homolog OS=Candida albicans (strain WO-1) GN=HST7 PE=3 SV=1 769 927 6.0E-12
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 740 915 6.0E-12
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 770 915 6.0E-12
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 703 931 6.0E-12
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 703 931 7.0E-12
sp|P27361|MK03_HUMAN Mitogen-activated protein kinase 3 OS=Homo sapiens GN=MAPK3 PE=1 SV=4 705 917 7.0E-12
sp|Q15759|MK11_HUMAN Mitogen-activated protein kinase 11 OS=Homo sapiens GN=MAPK11 PE=1 SV=2 748 913 7.0E-12
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 765 913 7.0E-12
sp|Q39024|MPK4_ARATH Mitogen-activated protein kinase 4 OS=Arabidopsis thaliana GN=MPK4 PE=1 SV=2 747 910 7.0E-12
sp|P48609|CDK5_DROME Cyclin-dependent kinase 5 homolog OS=Drosophila melanogaster GN=Cdk5 PE=1 SV=2 702 915 7.0E-12
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 705 915 8.0E-12
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 712 916 8.0E-12
sp|P0CP68|HOG1_CRYNJ Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HOG1 PE=1 SV=1 714 913 8.0E-12
sp|Q56R42|HOG1_CRYNH Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=HOG1 PE=1 SV=1 714 913 8.0E-12
sp|P0CP69|HOG1_CRYNB Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HOG1 PE=3 SV=1 714 913 8.0E-12
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 741 913 8.0E-12
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 702 914 8.0E-12
sp|Q39023|MPK3_ARATH Mitogen-activated protein kinase 3 OS=Arabidopsis thaliana GN=MPK3 PE=1 SV=2 747 913 9.0E-12
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 694 913 9.0E-12
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 747 915 9.0E-12
sp|P42525|ERK1_DICDI Extracellular signal-regulated kinase 1 OS=Dictyostelium discoideum GN=erkA PE=2 SV=2 741 913 9.0E-12
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 765 913 9.0E-12
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 686 911 9.0E-12
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 748 958 9.0E-12
sp|Q9CAL3|CRK2_ARATH Cysteine-rich receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=2 SV=1 703 943 9.0E-12
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 703 913 9.0E-12
sp|Q9NYV4|CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens GN=CDK12 PE=1 SV=2 702 913 9.0E-12
sp|Q5VST9|OBSCN_HUMAN Obscurin OS=Homo sapiens GN=OBSCN PE=1 SV=3 699 911 1.0E-11
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 635 913 1.0E-11
sp|Q9LHI7|NEK7_ARATH Serine/threonine-protein kinase Nek7 OS=Arabidopsis thaliana GN=NEK7 PE=2 SV=1 738 917 1.0E-11
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 771 915 1.0E-11
sp|Q4PC06|HOG1_USTMA Mitogen-activated protein kinase HOG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HOG1 PE=3 SV=1 714 913 1.0E-11
sp|Q9SIT1|TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana GN=TMK3 PE=2 SV=1 677 1020 1.0E-11
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 747 913 1.0E-11
sp|Q95NE7|MK14_PANTR Mitogen-activated protein kinase 14 OS=Pan troglodytes GN=MAPK14 PE=2 SV=3 732 913 1.0E-11
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 719 930 1.0E-11
sp|P49186|MK09_RAT Mitogen-activated protein kinase 9 OS=Rattus norvegicus GN=Mapk9 PE=1 SV=1 708 920 1.0E-11
sp|Q8LF80|CKB21_ARATH Cyclin-dependent kinase B2-1 OS=Arabidopsis thaliana GN=CDKB2-1 PE=1 SV=2 703 917 1.0E-11
sp|Q54VC0|Y9865_DICDI Probable serine/threonine-protein kinase DDB_G0280461 OS=Dictyostelium discoideum GN=DDB_G0280461 PE=3 SV=1 727 913 1.0E-11
sp|Q3ECH2|Y1670_ARATH Probable receptor-like protein kinase At1g67000 OS=Arabidopsis thaliana GN=At1g67000 PE=2 SV=2 700 913 1.0E-11
sp|Q8G4G1|PKNA2_BIFLO Probable serine/threonine-protein kinase pknA2 OS=Bifidobacterium longum (strain NCC 2705) GN=pknA2 PE=3 SV=1 783 913 1.0E-11
sp|A2QRF6|HOG1_ASPNC Mitogen-activated protein kinase hog1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hog1 PE=3 SV=2 708 913 1.0E-11
sp|P47811|MK14_MOUSE Mitogen-activated protein kinase 14 OS=Mus musculus GN=Mapk14 PE=1 SV=3 732 913 1.0E-11
sp|Q6CR51|SSN3_KLULA Serine/threonine-protein kinase SSN3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSN3 PE=3 SV=1 741 913 1.0E-11
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 709 915 1.0E-11
sp|Q38774|CDC2C_ANTMA Cell division control protein 2 homolog C OS=Antirrhinum majus GN=CDC2C PE=2 SV=1 702 915 1.0E-11
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 702 916 1.0E-11
sp|P70618|MK14_RAT Mitogen-activated protein kinase 14 OS=Rattus norvegicus GN=Mapk14 PE=1 SV=3 732 913 1.0E-11
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 703 916 1.0E-11
sp|O42376|MK12_DANRE Mitogen-activated protein kinase 12 OS=Danio rerio GN=mapk12 PE=2 SV=1 702 913 1.0E-11
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 697 913 1.0E-11
sp|P70032|PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis GN=plk1 PE=1 SV=1 709 1021 1.0E-11
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 702 913 2.0E-11
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 702 913 2.0E-11
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 702 931 2.0E-11
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 740 913 2.0E-11
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 720 915 2.0E-11
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 703 913 2.0E-11
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 771 915 2.0E-11
sp|P53779|MK10_HUMAN Mitogen-activated protein kinase 10 OS=Homo sapiens GN=MAPK10 PE=1 SV=2 660 920 2.0E-11
sp|Q2WGK3|HOG1_TRIHA Mitogen-activated protein kinase hog1 OS=Trichoderma harzianum GN=hog1 PE=1 SV=1 741 913 2.0E-11
sp|Q5ZKN1|CDK9_CHICK Cyclin-dependent kinase 9 OS=Gallus gallus GN=CDK9 PE=2 SV=1 701 913 2.0E-11
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 686 913 2.0E-11
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 740 913 2.0E-11
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 703 913 2.0E-11
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 702 920 2.0E-11
sp|Q4WUN7|MPKC_ASPFU Mitogen-activated protein kinase mpkC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mpkC PE=2 SV=2 701 913 2.0E-11
sp|Q61831|MK10_MOUSE Mitogen-activated protein kinase 10 OS=Mus musculus GN=Mapk10 PE=1 SV=2 660 920 2.0E-11
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 771 915 2.0E-11
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 683 913 2.0E-11
sp|Q62407|SPEG_MOUSE Striated muscle-specific serine/threonine-protein kinase OS=Mus musculus GN=Speg PE=1 SV=2 747 911 2.0E-11
sp|O02812|MK14_CANLF Mitogen-activated protein kinase 14 OS=Canis lupus familiaris GN=MAPK14 PE=2 SV=3 732 913 2.0E-11
sp|Q16539|MK14_HUMAN Mitogen-activated protein kinase 14 OS=Homo sapiens GN=MAPK14 PE=1 SV=3 732 913 2.0E-11
sp|P40417|ERKA_DROME Mitogen-activated protein kinase ERK-A OS=Drosophila melanogaster GN=rl PE=1 SV=3 708 917 2.0E-11
sp|Q63638|SPEG_RAT Striated muscle-specific serine/threonine-protein kinase OS=Rattus norvegicus GN=Speg PE=1 SV=2 747 911 2.0E-11
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 770 916 2.0E-11
sp|Q9S2C0|PKSC_STRCO Serine/threonine-protein kinase PksC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pksC PE=3 SV=1 770 913 2.0E-11
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 702 915 2.0E-11
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 740 918 2.0E-11
sp|Q15772|SPEG_HUMAN Striated muscle preferentially expressed protein kinase OS=Homo sapiens GN=SPEG PE=1 SV=4 747 911 2.0E-11
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 770 942 2.0E-11
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 771 915 2.0E-11
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 709 913 2.0E-11
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 686 915 2.0E-11
sp|Q550L8|IFKB_DICDI Probable serine/threonine-protein kinase ifkB OS=Dictyostelium discoideum GN=ifkB PE=2 SV=1 797 872 2.0E-11
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 766 910 2.0E-11
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 703 915 2.0E-11
sp|Q75Q66|HOG1_COLOR Mitogen-activated protein kinase HOG1 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=HOG1 PE=3 SV=1 741 913 2.0E-11
sp|Q40531|NTF6_TOBAC Mitogen-activated protein kinase homolog NTF6 OS=Nicotiana tabacum GN=NTF6 PE=2 SV=1 743 913 3.0E-11
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 703 913 3.0E-11
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 703 915 3.0E-11
sp|Q10N20|MPK5_ORYSJ Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. japonica GN=MPK5 PE=1 SV=1 740 913 3.0E-11
sp|A2XFC8|MPK5_ORYSI Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. indica GN=MPK5 PE=1 SV=2 740 913 3.0E-11
sp|Q6PWX2|HOG1_BEABA Mitogen-activated protein kinase HOG1 OS=Beauveria bassiana GN=HOG1 PE=3 SV=1 741 913 3.0E-11
sp|Q15772|SPEG_HUMAN Striated muscle preferentially expressed protein kinase OS=Homo sapiens GN=SPEG PE=1 SV=4 703 912 4.0E-10
sp|Q5VST9|OBSCN_HUMAN Obscurin OS=Homo sapiens GN=OBSCN PE=1 SV=3 759 909 5.0E-07
sp|Q696W0|SPEG_DANRE Striated muscle preferentially expressed protein kinase OS=Danio rerio GN=speg PE=2 SV=1 784 918 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1298
MSFSNSGGGTLALPSPTHAHHMDVTSAVRGLRRSISRSPSKLLSRTSSQSSEGSQQASPQSPCRRFGSTPSRPSL
SPSHPQTAPPAVSATHAFTPLRPSIRLSLRSARSAKSSPPSSRPLARTRASPKSPLKRALSDAADSGNSHSSSSP
ATTSPGQENSNTSRGSTPRRHPEKPTRHSVHLDVSGAASQYSFLKALDASDSYMVSTTGALKRSDATMNLDHPNQ
GSPVAKRRSLHGISSLGQNEDLNVFGTNLSASQSFDIHEDLQSEYELIGASDSSNGDSSDAAAQHDPSTPTSPAS
NMPKRSSSLRRSTLQQRYGEKGSLGRRTGERQLAQMAAETSTPARNRPRLSTDHFLPPQVARDSPFSPDAPPPTL
STHAPDGKGHRPHPLSKTLTTSTSGNSLKEETATFVPAAVPSDKPKPHPFSRSLPLNATRPTARSMNEHIKAVAT
PSQSHQLWVGAFNSTGLISKVNRNPEEEAEKKIAPPDTPCKKHTNPFATFPPPAGSAIKRKNNNRNSFAGIPSSR
GPESFGVPGKGLSIFQRGSAALNARRGSVLSLELEDRMLFGEPAELSSLLDGEIPPTPTKNTLTPSLSNLSEQSL
ESPSANRTFTLPLSAVKPTPSRESSSSPVDGRRTPQTPQENLLPLDTSRLSISQADNLGESTMPPPVTPTAGRDF
RSSTSIFVTPVNGRVSNIDNDSSLYAKFDKVEQVGKGEFSTVYRVTKLEHANAFANGSATPGDDVARSPTRGQVF
AVKKSKHSFHGPKGRDVKLREAHILKALTHAEHVVQYVDSWEHNSHLYIQTEFCEEGTLDKFLGNVGRGGRLDDF
RIFKILQDLCLGLKEIHDAGFMHLDMKPANILINFEGALKIGDFGLAQACSAKEVDVEGDREYMAPEMLVGKAGP
AADVFSLGLMTLEAAANVVLPDNGPTWIALRSGDLSEVPSLTWTPSIEVQRDATGNPSSHSDDLDSDKAPSSADG
LFGSCKRSELQQPPDFMVEAFHPSSLDSIVRWMTAEHPEDRPLVDQVLDLEGLRWVAEHRNAPATVYEGNWGPVE
LFPVSIAADSDTEMTDV*
Coding >Hirsu2|1298
ATGTCCTTCTCCAACAGCGGCGGGGGCACCTTGGCGCTGCCCTCGCCCACACACGCCCATCATATGGACGTGACG
TCGGCCGTCCGCGGTCTGCGCCGCTCCATCTCGCGATCCCCCTCCAAGTTGTTGTCCCGCACAAGCTCACAGAGC
TCCGAAGGCTCACAGCAGGCCTCGCCTCAGTCGCCCTGCCGACGCTTCGGCTCTACACCGTCGCGGCCTTCGCTT
TCGCCTTCGCACCCACAGACGGCCCCCCCGGCCGTCTCTGCGACCCACGCCTTTACGCCACTGCGCCCCAGCATC
AGGCTGTCGCTGCGCTCCGCCAGGTCGGCCAAGTCGTCTCCGCCATCGTCGCGCCCCCTCGCGCGCACGCGCGCG
TCGCCCAAGAGCCCCCTGAAACGAGCCCTGAGCGACGCTGCTGATTCGGGAAACTCGCACTCGTCATCGTCGCCC
GCCACGACCTCCCCAGGCCAGGAAAACAGCAACACCTCCCGTGGCTCGACGCCACGGAGGCACCCCGAGAAGCCG
ACGCGCCACAGCGTGCACCTGGATGTGTCGGGGGCTGCCTCGCAGTACTCGTTCCTGAAAGCCCTGGACGCCAGC
GACTCCTACATGGTCTCTACGACCGGTGCACTCAAGCGCAGTGATGCGACTATGAACCTGGATCATCCAAACCAG
GGGAGCCCGGTGGCCAAGCGACGCAGTCTGCACGGCATCTCCAGCCTTGGCCAGAACGAGGACCTGAACGTCTTC
GGAACCAACCTCAGCGCGTCGCAGAGCTTCGACATCCACGAGGACCTCCAGTCCGAGTATGAGCTGATCGGGGCC
TCGGACAGCAGCAACGGAGATTCGTCGGACGCAGCCGCGCAACACGACCCCTCGACGCCGACGTCGCCAGCATCG
AACATGCCCAAGCGGTCCTCTTCGCTCCGCAGGTCGACCTTGCAGCAGCGATACGGAGAAAAGGGATCTTTGGGC
AGAAGGACGGGCGAGCGCCAACTGGCGCAGATGGCCGCCGAAACATCCACTCCCGCCCGTAACCGGCCCCGTCTC
TCAACGGACCACTTTCTTCCTCCTCAAGTCGCCCGGGACAGCCCCTTCTCTCCGGACGCTCCTCCGCCGACTTTG
TCCACGCATGCACCAGACGGCAAGGGCCATCGGCCTCACCCGCTCTCCAAGACCCTGACGACATCGACGTCGGGG
AACAGCCTGAAGGAGGAGACCGCGACGTTCGTGCCGGCCGCCGTGCCTTCCGACAAGCCCAAGCCTCACCCGTTT
TCCCGATCTCTCCCGCTCAACGCGACGAGACCGACGGCCCGCTCTATGAACGAGCACATCAAGGCGGTCGCGACG
CCAAGCCAGTCCCATCAGCTTTGGGTCGGCGCCTTCAACTCGACGGGACTGATTTCCAAAGTCAATCGCAACCCC
GAAGAGGAGGCGGAGAAGAAGATCGCACCTCCCGACACGCCGTGCAAGAAGCACACGAACCCCTTCGCGACCTTT
CCTCCTCCGGCTGGCAGCGCTATCAAGAGAAAGAATAACAACCGAAATTCATTTGCCGGTATCCCTTCGAGCCGC
GGCCCGGAGTCGTTCGGCGTGCCGGGAAAAGGGCTGTCCATCTTCCAGCGCGGGTCTGCGGCGCTCAACGCACGC
CGAGGGAGCGTCCTGAGCTTGGAGTTGGAGGACCGCATGCTGTTTGGCGAACCTGCCGAGCTGTCGAGCCTGCTC
GACGGGGAGATTCCGCCCACGCCCACCAAGAATACGCTCACGCCGAGCCTGAGCAACCTCAGCGAGCAGTCGCTC
GAGAGCCCCAGCGCCAACCGCACCTTTACCCTGCCTCTTTCGGCTGTCAAGCCCACGCCCTCGCGAGAATCATCG
TCGAGCCCGGTCGACGGACGGAGGACGCCTCAGACGCCGCAGGAAAACCTCCTTCCGCTGGACACCAGCCGTCTC
TCCATCTCTCAAGCCGACAATCTTGGGGAGAGCACGATGCCGCCCCCGGTGACGCCGACGGCCGGCCGTGACTTT
CGATCGTCGACGAGCATCTTCGTCACGCCGGTGAATGGTCGCGTGAGCAACATCGACAACGACTCAAGCCTCTAC
GCCAAATTCGACAAGGTCGAGCAGGTCGGCAAGGGCGAGTTCTCGACGGTGTATCGGGTGACGAAGCTGGAGCAC
GCCAATGCGTTTGCCAACGGCAGCGCCACGCCCGGCGACGACGTTGCCCGCAGCCCTACCAGAGGCCAAGTCTTT
GCCGTCAAGAAGAGCAAGCACTCGTTCCACGGCCCCAAGGGCCGAGACGTGAAGCTCCGCGAGGCGCACATCCTC
AAGGCATTGACGCACGCCGAGCACGTGGTGCAATATGTCGACAGCTGGGAACACAATTCTCATTTGTATATACAG
ACCGAGTTCTGCGAGGAGGGGACTCTGGACAAATTTTTGGGCAATGTGGGACGCGGCGGGAGGTTGGATGACTTC
CGCATCTTCAAGATCTTGCAGGATCTCTGTCTGGGCCTGAAGGAGATCCACGACGCCGGATTCATGCACCTGGAC
ATGAAGCCGGCGAACATTCTCATCAACTTTGAGGGAGCGCTGAAGATTGGAGACTTCGGACTGGCGCAGGCGTGC
TCGGCGAAAGAAGTCGACGTCGAGGGCGACCGCGAGTACATGGCGCCCGAGATGCTGGTGGGCAAGGCCGGCCCG
GCAGCGGACGTCTTCTCCCTCGGCCTGATGACGCTGGAGGCGGCGGCCAACGTGGTGCTTCCCGACAACGGGCCG
ACGTGGATTGCCCTGAGATCGGGCGACCTGTCCGAGGTGCCGAGCCTGACGTGGACCCCGTCCATCGAGGTGCAG
CGAGACGCCACAGGCAACCCGTCTTCCCACAGCGACGACCTCGACAGCGACAAGGCGCCCAGCTCGGCCGATGGC
CTGTTTGGATCTTGCAAGCGATCGGAGCTGCAGCAGCCGCCGGACTTTATGGTGGAGGCGTTCCATCCGAGCTCG
CTTGACTCCATCGTGAGGTGGATGACGGCCGAGCACCCCGAGGACCGGCCTCTGGTCGACCAGGTGCTCGACCTC
GAGGGCTTGCGGTGGGTGGCGGAGCATCGCAATGCGCCGGCGACGGTATACGAAGGCAACTGGGGGCCGGTCGAG
CTGTTCCCCGTCTCGATCGCCGCCGACAGCGACACAGAAATGACGGACGTGTGA
Transcript >Hirsu2|1298
ATGTCCTTCTCCAACAGCGGCGGGGGCACCTTGGCGCTGCCCTCGCCCACACACGCCCATCATATGGACGTGACG
TCGGCCGTCCGCGGTCTGCGCCGCTCCATCTCGCGATCCCCCTCCAAGTTGTTGTCCCGCACAAGCTCACAGAGC
TCCGAAGGCTCACAGCAGGCCTCGCCTCAGTCGCCCTGCCGACGCTTCGGCTCTACACCGTCGCGGCCTTCGCTT
TCGCCTTCGCACCCACAGACGGCCCCCCCGGCCGTCTCTGCGACCCACGCCTTTACGCCACTGCGCCCCAGCATC
AGGCTGTCGCTGCGCTCCGCCAGGTCGGCCAAGTCGTCTCCGCCATCGTCGCGCCCCCTCGCGCGCACGCGCGCG
TCGCCCAAGAGCCCCCTGAAACGAGCCCTGAGCGACGCTGCTGATTCGGGAAACTCGCACTCGTCATCGTCGCCC
GCCACGACCTCCCCAGGCCAGGAAAACAGCAACACCTCCCGTGGCTCGACGCCACGGAGGCACCCCGAGAAGCCG
ACGCGCCACAGCGTGCACCTGGATGTGTCGGGGGCTGCCTCGCAGTACTCGTTCCTGAAAGCCCTGGACGCCAGC
GACTCCTACATGGTCTCTACGACCGGTGCACTCAAGCGCAGTGATGCGACTATGAACCTGGATCATCCAAACCAG
GGGAGCCCGGTGGCCAAGCGACGCAGTCTGCACGGCATCTCCAGCCTTGGCCAGAACGAGGACCTGAACGTCTTC
GGAACCAACCTCAGCGCGTCGCAGAGCTTCGACATCCACGAGGACCTCCAGTCCGAGTATGAGCTGATCGGGGCC
TCGGACAGCAGCAACGGAGATTCGTCGGACGCAGCCGCGCAACACGACCCCTCGACGCCGACGTCGCCAGCATCG
AACATGCCCAAGCGGTCCTCTTCGCTCCGCAGGTCGACCTTGCAGCAGCGATACGGAGAAAAGGGATCTTTGGGC
AGAAGGACGGGCGAGCGCCAACTGGCGCAGATGGCCGCCGAAACATCCACTCCCGCCCGTAACCGGCCCCGTCTC
TCAACGGACCACTTTCTTCCTCCTCAAGTCGCCCGGGACAGCCCCTTCTCTCCGGACGCTCCTCCGCCGACTTTG
TCCACGCATGCACCAGACGGCAAGGGCCATCGGCCTCACCCGCTCTCCAAGACCCTGACGACATCGACGTCGGGG
AACAGCCTGAAGGAGGAGACCGCGACGTTCGTGCCGGCCGCCGTGCCTTCCGACAAGCCCAAGCCTCACCCGTTT
TCCCGATCTCTCCCGCTCAACGCGACGAGACCGACGGCCCGCTCTATGAACGAGCACATCAAGGCGGTCGCGACG
CCAAGCCAGTCCCATCAGCTTTGGGTCGGCGCCTTCAACTCGACGGGACTGATTTCCAAAGTCAATCGCAACCCC
GAAGAGGAGGCGGAGAAGAAGATCGCACCTCCCGACACGCCGTGCAAGAAGCACACGAACCCCTTCGCGACCTTT
CCTCCTCCGGCTGGCAGCGCTATCAAGAGAAAGAATAACAACCGAAATTCATTTGCCGGTATCCCTTCGAGCCGC
GGCCCGGAGTCGTTCGGCGTGCCGGGAAAAGGGCTGTCCATCTTCCAGCGCGGGTCTGCGGCGCTCAACGCACGC
CGAGGGAGCGTCCTGAGCTTGGAGTTGGAGGACCGCATGCTGTTTGGCGAACCTGCCGAGCTGTCGAGCCTGCTC
GACGGGGAGATTCCGCCCACGCCCACCAAGAATACGCTCACGCCGAGCCTGAGCAACCTCAGCGAGCAGTCGCTC
GAGAGCCCCAGCGCCAACCGCACCTTTACCCTGCCTCTTTCGGCTGTCAAGCCCACGCCCTCGCGAGAATCATCG
TCGAGCCCGGTCGACGGACGGAGGACGCCTCAGACGCCGCAGGAAAACCTCCTTCCGCTGGACACCAGCCGTCTC
TCCATCTCTCAAGCCGACAATCTTGGGGAGAGCACGATGCCGCCCCCGGTGACGCCGACGGCCGGCCGTGACTTT
CGATCGTCGACGAGCATCTTCGTCACGCCGGTGAATGGTCGCGTGAGCAACATCGACAACGACTCAAGCCTCTAC
GCCAAATTCGACAAGGTCGAGCAGGTCGGCAAGGGCGAGTTCTCGACGGTGTATCGGGTGACGAAGCTGGAGCAC
GCCAATGCGTTTGCCAACGGCAGCGCCACGCCCGGCGACGACGTTGCCCGCAGCCCTACCAGAGGCCAAGTCTTT
GCCGTCAAGAAGAGCAAGCACTCGTTCCACGGCCCCAAGGGCCGAGACGTGAAGCTCCGCGAGGCGCACATCCTC
AAGGCATTGACGCACGCCGAGCACGTGGTGCAATATGTCGACAGCTGGGAACACAATTCTCATTTGTATATACAG
ACCGAGTTCTGCGAGGAGGGGACTCTGGACAAATTTTTGGGCAATGTGGGACGCGGCGGGAGGTTGGATGACTTC
CGCATCTTCAAGATCTTGCAGGATCTCTGTCTGGGCCTGAAGGAGATCCACGACGCCGGATTCATGCACCTGGAC
ATGAAGCCGGCGAACATTCTCATCAACTTTGAGGGAGCGCTGAAGATTGGAGACTTCGGACTGGCGCAGGCGTGC
TCGGCGAAAGAAGTCGACGTCGAGGGCGACCGCGAGTACATGGCGCCCGAGATGCTGGTGGGCAAGGCCGGCCCG
GCAGCGGACGTCTTCTCCCTCGGCCTGATGACGCTGGAGGCGGCGGCCAACGTGGTGCTTCCCGACAACGGGCCG
ACGTGGATTGCCCTGAGATCGGGCGACCTGTCCGAGGTGCCGAGCCTGACGTGGACCCCGTCCATCGAGGTGCAG
CGAGACGCCACAGGCAACCCGTCTTCCCACAGCGACGACCTCGACAGCGACAAGGCGCCCAGCTCGGCCGATGGC
CTGTTTGGATCTTGCAAGCGATCGGAGCTGCAGCAGCCGCCGGACTTTATGGTGGAGGCGTTCCATCCGAGCTCG
CTTGACTCCATCGTGAGGTGGATGACGGCCGAGCACCCCGAGGACCGGCCTCTGGTCGACCAGGTGCTCGACCTC
GAGGGCTTGCGGTGGGTGGCGGAGCATCGCAATGCGCCGGCGACGGTATACGAAGGCAACTGGGGGCCGGTCGAG
CTGTTCCCCGTCTCGATCGCCGCCGACAGCGACACAGAAATGACGGACGTGTGA
Gene >Hirsu2|1298
ATGTCCTTCTCCAACAGCGGCGGGGGCACCTTGGCGCTGCCCTCGCCCACACACGCCCATCATATGGACGTGACG
TCGGCCGTCCGCGGTCTGCGCCGCTCCATCTCGCGATCCCCCTCCAAGTTGTTGTCCCGCACAAGCTCACAGAGC
TCCGAAGGCTCACAGCAGGCCTCGCCTCAGTCGCCCTGCCGACGCTTCGGCTCTACACCGTCGCGGCCTTCGCTT
TCGCCTTCGCACCCACAGACGGCCCCCCCGGCCGTCTCTGCGACCCACGCCTTTACGCCACTGCGCCCCAGCATC
AGGCTGTCGCTGCGCTCCGCCAGGTCGGCCAAGTCGTCTCCGCCATCGTCGCGCCCCCTCGCGCGCACGCGCGCG
TCGCCCAAGAGCCCCCTGAAACGAGCCCTGAGCGACGCTGCTGATTCGGGAAACTCGCACTCGTCATCGTCGCCC
GCCACGACCTCCCCAGGCCAGGAAAACAGCAACACCTCCCGTGGCTCGACGCCACGGAGGCACCCCGAGAAGCCG
ACGCGCCACAGCGTGCACCTGGATGTGTCGGGGGCTGCCTCGCAGTACTCGTTCCTGAAAGCCCTGGACGCCAGC
GACTCCTACATGGTCTCTACGACCGGTGCACTCAAGCGCAGTGATGCGACTATGAACCTGGATCATCCAAACCAG
GGGAGCCCGGTGGCCAAGCGACGCAGTCTGCACGGCATCTCCAGCCTTGGCCAGAACGAGGACCTGAACGTCTTC
GGAACCAACCTCAGCGCGTCGCAGAGCTTCGACATCCACGAGGACCTCCAGTCCGAGTATGAGCTGATCGGGGCC
TCGGACAGCAGCAACGGAGATTCGTCGGACGCAGCCGCGCAACACGACCCCTCGACGCCGACGTCGCCAGCATCG
AACATGCCCAAGCGGTCCTCTTCGCTCCGCAGGTCGACCTTGCAGCAGCGATACGGAGAAAAGGGATCTTTGGGC
AGAAGGACGGGCGAGCGCCAACTGGCGCAGATGGCCGCCGAAACATCCACTCCCGCCCGTAACCGGCCCCGTCTC
TCAACGGACCACTTTCTTCCTCCTCAAGTCGCCCGGGACAGCCCCTTCTCTCCGGACGCTCCTCCGCCGACTTTG
TCCACGCATGCACCAGACGGCAAGGGCCATCGGCCTCACCCGCTCTCCAAGACCCTGACGACATCGACGTCGGGG
AACAGCCTGAAGGAGGAGACCGCGACGTTCGTGCCGGCCGCCGTGCCTTCCGACAAGCCCAAGCCTCACCCGTTT
TCCCGATCTCTCCCGCTCAACGCGACGAGACCGACGGCCCGCTCTATGAACGAGCACATCAAGGCGGTCGCGACG
CCAAGCCAGTCCCATCAGCTTTGGGTCGGCGCCTTCAACTCGACGGGACTGATTTCCAAAGTCAATCGCAACCCC
GAAGAGGAGGCGGAGAAGAAGATCGCACCTCCCGACACGCCGTGCAAGAAGCACACGAACCCCTTCGCGACCTTT
CCTCCTCCGGCTGGCAGCGCTATCAAGAGAAAGAATAACAACCGAAATTCATTTGCCGGTATCCCTTCGAGCCGC
GGCCCGGAGTCGTTCGGCGTGCCGGGAAAAGGGCTGTCCATCTTCCAGCGCGGGTCTGCGGCGCTCAACGCACGC
CGAGGGAGCGTCCTGAGCTTGGAGTTGGAGGACCGCATGCTGTTTGGCGAACCTGCCGAGCTGTCGAGCCTGCTC
GACGGGGAGATTCCGCCCACGCCCACCAAGAATACGCTCACGCCGAGCCTGAGCAACCTCAGCGAGCAGTCGCTC
GAGAGCCCCAGCGCCAACCGCACCTTTACCCTGCCTCTTTCGGCTGTCAAGCCCACGCCCTCGCGAGAATCATCG
TGTAAGTTGAACCAGGAAGAAACGTCGAGAATAGCCCGGGGAGACGACGCGCAACCTCTCGGCGCCGATCGACCC
GCAGCTGCCGCTGCGCTCGACCGCCAGCCGTCTCCCACCCCCTGCCTGGCACAGCGTTCGTCTTTCGGCCGATCG
AGGCTTTTCAAAGGATCCAACGCGCCGTCACCTCTTGCACCCCAGACTTCACTCTTATCCGTGCCGCGCTCGGAG
AATGCATTCACTAAATTTGCGTCGGTTGATCCAGCGAGCCCGGTCGACGGACGGAGGACGCCTCAGACGCCGCAG
GAAAACCTCCTTCCGCTGGACACCAGCCGTCTCTCCATCTCTCAAGCCGACAATCTTGGGGAGAGCACGATGCCG
CCCCCGGTGACGCCGACGGCCGGCCGTGACTTTCGATCGTCGACGAGCATCTTCGTCACGCCGGTGAATGGTCGC
GTGAGCAACATCGACAACGACTCAAGCCTCTACGCCAAATTCGACAAGGTCGAGCAGGTCGGCAAGGGCGAGTTC
TCGACGGTGTATCGGGTGACGAAGCTGGAGCACGCCAATGCGTTTGCCAACGGCAGCGCCACGCCCGGCGACGAC
GTTGCCCGCAGCCCTACCAGAGGCCAAGTCTTTGCCGTCAAGAAGAGCAAGCACTCGTTCCACGGCCCCAAGGGC
CGAGACGTGAAGCTCCGCGAGGCGCACATCCTCAAGGCATTGACGCACGCCGAGCACGTGGTGCAATATGTCGAC
AGCTGGGAACACAATTCTCATTTGTATATACAGACCGAGTTCTGCGAGGAGGGGACTCTGGACAAATTTTTGGGC
AATGTGGGACGCGGCGGGAGGTTGGATGACTTCCGCATCTTCAAGATCTTGCAGGATCTCTGTCTGGTAAGCCGA
GGCTGCCCCGAAGACGAGGCGAGACGATGCTGACGGTGGGCGTCCAACAGGGCCTGAAGGAGATCCACGACGCCG
GATTCATGCACCTGGACATGAAGCCGGCGAACATTCTCATCAACTTTGAGGGAGCGCTGAAGATTGGAGACTTCG
GACTGGCGCAGGCGTGCTCGGCGAAAGAAGTCGACGTCGAGGGCGACCGCGAGTACATGGCGCCCGAGATGCTGG
TGGGCAAGGCCGGCCCGGCAGCGGACGTCTTCTCCCTCGGCCTGATGACGCTGGAGGCGGCGGCCAACGTGGTGC
TTCCCGACAACGGGCCGACGTGGATTGCCCTGAGATCGGGCGACCTGTCCGAGGTGCCGAGCCTGACGTGGACCC
CGTCCATCGAGGTGCAGCGAGACGCCACAGGCAACCCGTCTTCCCACAGCGACGACCTCGACAGCGACAAGGCGC
CCAGCTCGGCCGATGGCCTGTTTGGATCTTGCAAGCGATCGGAGCTGCAGCAGCCGCCGGACTTTATGGTGGAGG
CGTTCCATCCGAGCTCGCTTGACTCCATCGTGAGGTGGATGACGGCCGAGCACCCCGAGGACCGGCCTCTGGTCG
ACCAGGTGCTCGACCTCGAGGGCTTGCGGTGGGTGGCGGAGCATCGCAATGCGCCGGCGACGGTATACGAAGGCA
ACTGGGGGCCGGTCGAGCTGTTCCCCGTCTCGATCGCCGCCGACAGCGACACAGAAATGACGGACGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail