Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1296
Gene name
LocationContig_1283:838..2455
Strand-
Gene length (bp)1617
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06068 TIP49 TIP49 P-loop domain 5.1E-167 15 369
PF17856 TIP49_C TIP49 AAA-lid domain 6.5E-25 375 440
PF00004 AAA ATPase family associated with various cellular activities (AAA) 4.3E-07 67 119
PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain 2.4E-06 39 92

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P60122|RUVB1_MOUSE RuvB-like 1 OS=Mus musculus GN=Ruvbl1 PE=1 SV=1 2 454 0.0E+00
sp|Q4ICA8|RUVB1_GIBZE RuvB-like helicase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RVB1 PE=3 SV=1 1 457 0.0E+00
sp|O17607|RUVB1_CAEEL RuvB-like 1 OS=Caenorhabditis elegans GN=ruvb-1 PE=1 SV=2 1 451 0.0E+00
sp|Q9FMR9|RIN1_ARATH RuvB-like protein 1 OS=Arabidopsis thaliana GN=RIN1 PE=1 SV=1 2 457 0.0E+00
sp|P0CR27|RUVB1_CRYNB RuvB-like helicase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RVB1 PE=3 SV=1 12 448 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P60122|RUVB1_MOUSE RuvB-like 1 OS=Mus musculus GN=Ruvbl1 PE=1 SV=1 2 454 0.0E+00
sp|Q4ICA8|RUVB1_GIBZE RuvB-like helicase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RVB1 PE=3 SV=1 1 457 0.0E+00
sp|O17607|RUVB1_CAEEL RuvB-like 1 OS=Caenorhabditis elegans GN=ruvb-1 PE=1 SV=2 1 451 0.0E+00
sp|Q9FMR9|RIN1_ARATH RuvB-like protein 1 OS=Arabidopsis thaliana GN=RIN1 PE=1 SV=1 2 457 0.0E+00
sp|P0CR27|RUVB1_CRYNB RuvB-like helicase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RVB1 PE=3 SV=1 12 448 0.0E+00
sp|P0CR26|RUVB1_CRYNJ RuvB-like helicase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RVB1 PE=3 SV=1 12 448 0.0E+00
sp|Q9VH07|RUVB1_DROME RuvB-like helicase 1 OS=Drosophila melanogaster GN=pont PE=1 SV=1 2 454 0.0E+00
sp|Q29AK9|RUVB1_DROPS RuvB-like helicase 1 OS=Drosophila pseudoobscura pseudoobscura GN=pont PE=3 SV=1 2 454 0.0E+00
sp|Q8AWW7|RUVB1_DANRE RuvB-like 1 OS=Danio rerio GN=ruvbl1 PE=2 SV=1 2 454 0.0E+00
sp|Q4P112|RUVB1_USTMA RuvB-like helicase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RVB1 PE=3 SV=1 5 448 0.0E+00
sp|Q0IFL2|RUVB1_AEDAE RuvB-like helicase 1 OS=Aedes aegypti GN=pont PE=3 SV=1 2 454 0.0E+00
sp|Q9Y265|RUVB1_HUMAN RuvB-like 1 OS=Homo sapiens GN=RUVBL1 PE=1 SV=1 2 454 0.0E+00
sp|Q9DE26|RUVB1_XENLA RuvB-like 1 OS=Xenopus laevis GN=ruvbl1 PE=2 SV=1 2 454 0.0E+00
sp|P60123|RUVB1_RAT RuvB-like 1 OS=Rattus norvegicus GN=Ruvbl1 PE=1 SV=1 2 454 0.0E+00
sp|Q03940|RUVB1_YEAST RuvB-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVB1 PE=1 SV=1 1 453 0.0E+00
sp|Q750R1|RUVB1_ASHGO RuvB-like helicase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RVB1 PE=3 SV=1 1 457 0.0E+00
sp|Q6CQA9|RUVB1_KLULA RuvB-like helicase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RVB1 PE=3 SV=1 1 457 0.0E+00
sp|Q6FU78|RUVB1_CANGA RuvB-like helicase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RVB1 PE=3 SV=1 1 448 0.0E+00
sp|Q5A0W7|RUVB1_CANAL RuvB-like helicase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RVB1 PE=3 SV=1 1 448 0.0E+00
sp|Q6BI60|RUVB1_DEBHA RuvB-like helicase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RBV1 PE=3 SV=1 1 457 0.0E+00
sp|Q6CB52|RUVB1_YARLI RuvB-like helicase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RVB1 PE=3 SV=1 1 444 0.0E+00
sp|Q9C0X6|RUVB1_SCHPO RuvB-like helicase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rvb1 PE=3 SV=1 1 453 0.0E+00
sp|Q5BBV9|RUVB1_EMENI RuvB-like helicase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rvb1 PE=3 SV=3 1 454 0.0E+00
sp|Q4WPW8|RUVB1_ASPFU RuvB-like helicase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rvb1 PE=3 SV=1 1 454 0.0E+00
sp|Q8WZS3|RUVB1_NEUCR RuvB-like helicase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hel-1 PE=3 SV=1 1 457 0.0E+00
sp|Q8STP2|RUVB1_ENCCU RuvB-like protein 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RVB1 PE=1 SV=1 12 441 2.0E-141
sp|Q9DE27|RUVB2_XENLA RuvB-like 2 OS=Xenopus laevis GN=ruvbl2 PE=2 SV=1 3 448 5.0E-116
sp|P0CR29|RUVB2_CRYNB RuvB-like helicase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RVB2 PE=3 SV=1 15 445 2.0E-115
sp|P0CR28|RUVB2_CRYNJ RuvB-like helicase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RVB2 PE=3 SV=1 15 445 2.0E-115
sp|Q9WTM5|RUVB2_MOUSE RuvB-like 2 OS=Mus musculus GN=Ruvbl2 PE=1 SV=3 3 448 1.0E-114
sp|Q9Y230|RUVB2_HUMAN RuvB-like 2 OS=Homo sapiens GN=RUVBL2 PE=1 SV=3 3 448 2.0E-114
sp|Q2TBU9|RUVB2_BOVIN RuvB-like 2 OS=Bos taurus GN=RUVBL2 PE=2 SV=3 3 448 2.0E-114
sp|Q16TA2|RUVB2_AEDAE RuvB-like helicase 2 OS=Aedes aegypti GN=rept PE=3 SV=1 6 448 2.0E-113
sp|Q29DI0|RUVB2_DROPS RuvB-like helicase 2 OS=Drosophila pseudoobscura pseudoobscura GN=rept PE=3 SV=1 6 448 4.0E-113
sp|Q6C3X6|RUVB2_YARLI RuvB-like helicase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RVB2 PE=3 SV=2 17 449 7.0E-113
sp|Q9V3K3|RUVB2_DROME RuvB-like helicase 2 OS=Drosophila melanogaster GN=rept PE=1 SV=1 6 448 2.0E-112
sp|O94692|RUVB2_SCHPO RuvB-like helicase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rvb2 PE=1 SV=1 15 457 3.0E-111
sp|P83571|RUVB2_DANRE RuvB-like 2 OS=Danio rerio GN=ruvbl2 PE=1 SV=1 3 448 3.0E-110
sp|Q6BSB8|RUVB2_DEBHA RuvB-like helicase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RVB2 PE=3 SV=1 14 448 4.0E-108
sp|Q9GZH2|RUVB2_CAEEL RuvB-like 2 OS=Caenorhabditis elegans GN=ruvb-2 PE=1 SV=1 15 453 2.0E-107
sp|Q873C7|RUVB2_NEUCR RuvB-like helicase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hel-2 PE=3 SV=1 1 448 2.0E-107
sp|Q6CT29|RUVB2_KLULA RuvB-like helicase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RVB2 PE=3 SV=1 14 448 3.0E-106
sp|Q5AGZ9|RUVB2_CANAL RuvB-like helicase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RVB2 PE=3 SV=1 14 457 5.0E-106
sp|Q4WKH9|RUVB2_ASPFU RuvB-like helicase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rvb2 PE=3 SV=1 17 450 3.0E-105
sp|Q4P6N7|RUVB2_USTMA RuvB-like helicase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RVB2 PE=3 SV=1 15 452 6.0E-105
sp|Q12464|RUVB2_YEAST RuvB-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVB2 PE=1 SV=1 14 444 9.0E-105
sp|Q6FSF1|RUVB2_CANGA RuvB-like helicase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RVB2 PE=3 SV=1 14 448 2.0E-103
sp|Q755G5|RUVB2_ASHGO RuvB-like helicase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RVB2 PE=3 SV=2 14 448 3.0E-103
sp|Q4I948|RUVB2_GIBZE RuvB-like helicase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RVB2 PE=3 SV=2 17 449 3.0E-103
sp|Q54UW5|RUVB2_DICDI RuvB-like helicase 2 OS=Dictyostelium discoideum GN=rvb2 PE=1 SV=1 3 448 5.0E-103
sp|Q5BGK3|RUVB2_EMENI RuvB-like helicase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rvb2 PE=3 SV=2 17 449 2.0E-101
sp|Q8SU27|RUVB2_ENCCU RuvB-like helicase 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RVB2 PE=1 SV=1 14 450 1.0E-77
[Show less]

GO

GO Term Description Terminal node
GO:0009378 four-way junction helicase activity Yes
GO:0005524 ATP binding Yes
GO:0006281 DNA repair Yes
GO:0006310 DNA recombination Yes
GO:0003678 DNA helicase activity Yes
GO:1901265 nucleoside phosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006950 response to stress No
GO:0006259 DNA metabolic process No
GO:0016462 pyrophosphatase activity No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0050896 response to stimulus No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0090304 nucleic acid metabolic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0004386 helicase activity No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0051716 cellular response to stimulus No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0033554 cellular response to stress No
GO:0006725 cellular aromatic compound metabolic process No
GO:0017111 nucleoside-triphosphatase activity No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006974 cellular response to DNA damage stimulus No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1296
MVQISEVKGNKRDSRTAAHTHIKGLGLKSDGRAEVQAGGFVGQAPARESCGVVVDLIRAHKMAGRGVLLAGGPGT
GKTALALAISQELGTKIPFCPIVGSEIYSTEVKKTEMLMENFRRAIGLKVRETKEVYEGEVTELTPEEAENPLGG
YGKTISTLLIGLKSAKGQKKLRLDPSIYEAIQKERVTVGDVIYIEANTGACKRVGRSDAYATEFDLEAEEYVPIP
KGEVHKKKEIVQDVTLHDLDIANARPQGGQDIMSMMGQLMKPKMTEITEKLRAEINKVVSKYIDQGVAELVPGVL
FIDEAHMLDVECFTYLNRALESPIAPIVVLASNRGMCTIRGTDDIVAAHGIPTDFLARLLIIPTAPYQADEIKKI
VRIRASTEGVAISDAAIDKISDHGVRISLRYCLQLLTPASILAKANGRSQIDVKDVAECEDLFLDARRSASLLSG
EAGKGYIV*
Coding >Hirsu2|1296
ATGGTCCAGATCAGCGAGGTCAAGGGCAACAAGCGCGACAGCCGGACAGCCGCCCACACGCACATAAAGGGCCTC
GGGCTCAAGTCTGATGGGCGGGCAGAGGTCCAAGCAGGCGGATTCGTCGGCCAGGCGCCCGCACGAGAATCATGC
GGCGTCGTCGTCGACCTCATCCGAGCCCACAAGATGGCCGGTCGGGGCGTCTTGCTGGCGGGAGGGCCGGGCACC
GGAAAGACGGCGCTTGCGCTTGCCATCAGCCAGGAGCTCGGCACTAAAATCCCCTTCTGCCCTATCGTCGGCAGC
GAGATCTACTCGACCGAGGTCAAGAAGACGGAGATGCTGATGGAGAACTTCCGGAGGGCCATTGGCCTTAAGGTG
CGGGAGACGAAGGAGGTGTACGAGGGCGAAGTAACGGAGCTCACGCCCGAGGAGGCCGAGAACCCCCTGGGCGGC
TACGGGAAGACCATCAGCACGCTGCTTATCGGCCTCAAGAGCGCAAAGGGACAGAAGAAGCTCCGGCTGGACCCC
AGCATCTACGAGGCGATCCAGAAGGAGCGCGTCACCGTCGGCGATGTCATATACATCGAGGCCAACACGGGCGCG
TGCAAGCGGGTCGGCCGTTCGGACGCGTACGCCACCGAGTTCGACCTCGAGGCCGAGGAATACGTGCCGATCCCG
AAGGGCGAGGTGCACAAGAAGAAGGAGATTGTGCAGGACGTGACGCTGCACGACCTGGACATTGCCAACGCACGG
CCGCAGGGTGGCCAGGACATCATGAGCATGATGGGCCAGCTGATGAAGCCCAAGATGACGGAGATCACAGAGAAG
CTGCGGGCCGAGATCAACAAGGTCGTCAGCAAGTATATCGACCAAGGCGTGGCCGAACTGGTGCCCGGCGTACTG
TTCATCGACGAGGCACACATGCTCGACGTCGAGTGCTTCACCTACCTCAACCGAGCGCTGGAATCACCCATAGCC
CCAATCGTGGTGCTGGCGTCGAACCGTGGAATGTGCACAATAAGAGGCACGGACGATATTGTCGCAGCTCACGGC
ATTCCTACCGACTTTCTCGCCCGCCTGCTCATCATCCCCACGGCGCCTTACCAAGCAGACGAGATCAAGAAGATT
GTGCGGATACGGGCCTCGACCGAAGGCGTCGCCATCAGCGACGCGGCCATTGACAAGATCTCGGATCACGGCGTC
CGCATCAGCCTGCGGTACTGCCTGCAGCTGCTCACGCCGGCGAGCATCCTGGCCAAGGCCAACGGGCGCTCGCAG
ATTGACGTCAAGGACGTGGCCGAGTGCGAGGATCTGTTCCTCGACGCCCGGCGGAGCGCGTCGCTGCTGAGCGGC
GAGGCTGGGAAGGGCTACATTGTGTAG
Transcript >Hirsu2|1296
ATGGTCCAGATCAGCGAGGTCAAGGGCAACAAGCGCGACAGCCGGACAGCCGCCCACACGCACATAAAGGGCCTC
GGGCTCAAGTCTGATGGGCGGGCAGAGGTCCAAGCAGGCGGATTCGTCGGCCAGGCGCCCGCACGAGAATCATGC
GGCGTCGTCGTCGACCTCATCCGAGCCCACAAGATGGCCGGTCGGGGCGTCTTGCTGGCGGGAGGGCCGGGCACC
GGAAAGACGGCGCTTGCGCTTGCCATCAGCCAGGAGCTCGGCACTAAAATCCCCTTCTGCCCTATCGTCGGCAGC
GAGATCTACTCGACCGAGGTCAAGAAGACGGAGATGCTGATGGAGAACTTCCGGAGGGCCATTGGCCTTAAGGTG
CGGGAGACGAAGGAGGTGTACGAGGGCGAAGTAACGGAGCTCACGCCCGAGGAGGCCGAGAACCCCCTGGGCGGC
TACGGGAAGACCATCAGCACGCTGCTTATCGGCCTCAAGAGCGCAAAGGGACAGAAGAAGCTCCGGCTGGACCCC
AGCATCTACGAGGCGATCCAGAAGGAGCGCGTCACCGTCGGCGATGTCATATACATCGAGGCCAACACGGGCGCG
TGCAAGCGGGTCGGCCGTTCGGACGCGTACGCCACCGAGTTCGACCTCGAGGCCGAGGAATACGTGCCGATCCCG
AAGGGCGAGGTGCACAAGAAGAAGGAGATTGTGCAGGACGTGACGCTGCACGACCTGGACATTGCCAACGCACGG
CCGCAGGGTGGCCAGGACATCATGAGCATGATGGGCCAGCTGATGAAGCCCAAGATGACGGAGATCACAGAGAAG
CTGCGGGCCGAGATCAACAAGGTCGTCAGCAAGTATATCGACCAAGGCGTGGCCGAACTGGTGCCCGGCGTACTG
TTCATCGACGAGGCACACATGCTCGACGTCGAGTGCTTCACCTACCTCAACCGAGCGCTGGAATCACCCATAGCC
CCAATCGTGGTGCTGGCGTCGAACCGTGGAATGTGCACAATAAGAGGCACGGACGATATTGTCGCAGCTCACGGC
ATTCCTACCGACTTTCTCGCCCGCCTGCTCATCATCCCCACGGCGCCTTACCAAGCAGACGAGATCAAGAAGATT
GTGCGGATACGGGCCTCGACCGAAGGCGTCGCCATCAGCGACGCGGCCATTGACAAGATCTCGGATCACGGCGTC
CGCATCAGCCTGCGGTACTGCCTGCAGCTGCTCACGCCGGCGAGCATCCTGGCCAAGGCCAACGGGCGCTCGCAG
ATTGACGTCAAGGACGTGGCCGAGTGCGAGGATCTGTTCCTCGACGCCCGGCGGAGCGCGTCGCTGCTGAGCGGC
GAGGCTGGGAAGGGCTACATTGTGTAG
Gene >Hirsu2|1296
ATGGTCCAGATCAGCGAGGTCAAGGGCAACAAGCGCGACAGCCGGACAGCCGCCCACACGCACATAAAGGGCCTC
GGGCTCAAGTCTGATGGGCGGGCAGAGGTCCAAGCAGGCGGATTCGTCGGCCAGGCGCCCGCACGAGAAGTACCG
CATCCCCGGCTCATGCATGCCTTGGCAGGGTAGAGCTAACCTCGCCTCCGACACCAGTCATGCGGCGTCGTCGTC
GACCTCATCCGAGCCCACAAGATGGCCGGTCGGGGCGTCTTGCTGGCGGGAGGGCCGGGCACCGGAAAGACGGCG
CTTGCGCTTGCCATCAGCCAGGAGCTCGGCACTAAAATCCCCTTCTGCCCTATCGTCGGCAGCGAGATCTACTCG
ACCGAGGTCAAGAAGACGGAGATGCTGATGGAGAACTTCCGGAGGGCCATTGGCCTTAAGGTGCGGGAGACGAAG
GAGGTGTACGAGGGCGAAGTAACGGAGCTCACGCCCGAGGAGGCCGAGAACCCCCTGGGCGGCTACGGGAAGACC
ATCAGCACGCTGCTTATCGGCCTCAAGAGCGCAAAGGGACAGAAGAAGCTCCGGCTGGACCCCAGCATCTACGAG
GCGATCCAGAAGGAGCGCGTCACCGTCGGCGATGTCATATACATCGAGGCCAACACGGGCGCGTGCAAGCGGGTC
GGCCGTTCGGACGCGTACGCCACCGAGTTCGACCTCGAGGCCGAGGAATACGTGCCGATCCCGAAGGGCGAGGTG
CACAAGAAGAAGGAGATTGTGCAGGACGTGACGCTGCACGACCTGGACATTGCCAACGCACGGCCGCAGGGTGGC
CAGGACATCATGAGCATGATGGGCCAGCTGATGAAGCCCAAGATGACGGAGATCACAGAGAAGCTGCGGGCCGAG
ATCAACAAGGTCGTCAGCAAGTATATCGACCAAGGCGTGGCCGAACTGGTGCCCGGCGTACTGTTCATCGACGAG
GTAAGGTCCCCCCGGGATACGGCTGTCTCACCATGCAAAATCCTCGTGTGACGACGAGGTCGGCGTTGACAGGTG
GCCGGCTGGACAGGCACACATGCTCGACGTCGAGTGCTTCACCTACCTCAACCGAGCGCTGGAATCACCCATAGC
CCCAATCGTGGTGCTGGCGTCGAACCGTGGAATGTGCACAATAAGAGGCACGGACGATATTGTCGCAGCTCACGG
CATTCCTACCGACTTTCTCGCCCGCCTGCTCATCATCCCCACGGCGCCTTACCAAGCAGACGAGATCAAGAAGAT
TGTGCGGATACGGGCCTCGACCGAAGGCGTCGCCATCAGCGACGCGGCCATTGACAAGATCTCGGATCACGGCGT
CCGCATCAGCCTGCGGTACTGCCTGCAGCTGCTCACGCCGGCGAGGTAAGCCGTCGCCCCGGGTCGACCTCTGCC
AAGCGGTCCGCCCCTGTCTCCGGGCGGCAGGGACGAAGGAGTGCTGACAGAACGGACAGCATCCTGGCCAAGGCC
AACGGGCGCTCGCAGATTGACGTCAAGGACGTGGCCGAGTGCGAGGATCTGTTCCTCGACGCCCGGCGGAGCGCG
TCGCTGCTGAGCGGCGAGGCTGGGAAGGGCTACATTGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail