Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1289
Gene name
LocationContig_1280:4561..5737
Strand-
Gene length (bp)1176
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12955 DUF3844 Domain of unknown function (DUF3844) 1.5E-35 263 366

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74728|YH93_SCHPO Uncharacterized endoplasmic reticulum membrane protein C1709.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1709.03 PE=3 SV=2 169 364 5.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 327 349 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1289
MKLNAGLVAASCGLALASQPAAEVYLLPAREASSTATSLPAALARLVLLQRLAPTDQGPSSSDFPKDTSVEEVVS
ALNRFGKSTPPLFADGDDKAPSQLVVMLEGMTRGQMDDLGRTLGKGPAMTIPNPPSTSAHNDLVDFDFYGTGATN
AAGCKAQQITNPHEKCWGGKQSAYAKLDFEKDSTLVGDVLQSLKKVSQRELQTTLVLLPSTANSGSWSDRSRELR
RRQAEQVMTSVDQAAQAAVTNTAQNAYVLAPAQRILSCFPNENECASTTNNCSGHGSCMDKYAKEDGSTSKDACF
VCHCLSTRSESGSLTHWAGQTCAKKDVSVAFWLFAGFTLALVGIVWLAISMLLNVGQEKLPGVIGAGVSRSR*
Coding >Hirsu2|1289
ATGAAGCTGAACGCCGGGCTCGTTGCGGCCTCTTGCGGCCTCGCCCTGGCCTCGCAGCCAGCGGCCGAGGTCTAC
CTCCTGCCGGCCCGCGAGGCCTCGTCGACGGCGACGTCTCTGCCCGCCGCCCTGGCGCGCCTGGTGCTGCTGCAG
CGGCTGGCGCCCACCGACCAGGGCCCTTCGTCCAGCGACTTCCCCAAGGACACGAGCGTCGAAGAGGTCGTTTCC
GCGCTCAACCGGTTCGGGAAGTCTACCCCGCCGCTGTTCGCCGACGGCGACGACAAGGCGCCCAGCCAGCTCGTC
GTGATGCTGGAGGGCATGACGAGGGGGCAGATGGACGACTTGGGGCGCACGCTGGGCAAGGGGCCGGCCATGACG
ATTCCGAACCCGCCATCTACCAGCGCCCACAACGACCTTGTGGACTTTGATTTCTACGGCACCGGGGCAACGAAT
GCCGCCGGCTGCAAGGCGCAGCAGATCACCAACCCACACGAGAAATGCTGGGGCGGCAAGCAATCCGCCTATGCA
AAATTGGACTTCGAAAAGGACTCGACGCTTGTCGGTGACGTACTGCAAAGCCTGAAGAAGGTCTCGCAGCGTGAA
CTGCAGACGACACTGGTGCTGTTGCCCTCGACGGCAAACTCGGGCTCGTGGTCGGACCGGTCCCGAGAGCTGCGG
CGCCGGCAGGCGGAGCAGGTCATGACCTCGGTGGACCAGGCGGCGCAAGCAGCTGTGACGAACACGGCGCAGAAC
GCGTACGTGTTGGCGCCCGCGCAGCGCATCCTGTCGTGCTTCCCCAACGAGAACGAATGCGCCAGCACGACGAAC
AACTGCTCGGGCCACGGGTCGTGCATGGACAAGTATGCCAAGGAGGACGGGTCGACCAGCAAGGACGCCTGCTTC
GTCTGCCACTGCCTGAGCACCCGCAGCGAGTCCGGCAGCCTGACGCACTGGGCCGGGCAGACGTGTGCGAAGAAG
GACGTGAGCGTTGCCTTTTGGCTCTTTGCCGGCTTCACCCTTGCCCTGGTCGGCATCGTGTGGCTGGCGATCTCG
ATGCTGTTGAACGTCGGCCAGGAGAAGCTTCCAGGCGTCATCGGTGCGGGCGTCTCGCGGTCCAGATAG
Transcript >Hirsu2|1289
ATGAAGCTGAACGCCGGGCTCGTTGCGGCCTCTTGCGGCCTCGCCCTGGCCTCGCAGCCAGCGGCCGAGGTCTAC
CTCCTGCCGGCCCGCGAGGCCTCGTCGACGGCGACGTCTCTGCCCGCCGCCCTGGCGCGCCTGGTGCTGCTGCAG
CGGCTGGCGCCCACCGACCAGGGCCCTTCGTCCAGCGACTTCCCCAAGGACACGAGCGTCGAAGAGGTCGTTTCC
GCGCTCAACCGGTTCGGGAAGTCTACCCCGCCGCTGTTCGCCGACGGCGACGACAAGGCGCCCAGCCAGCTCGTC
GTGATGCTGGAGGGCATGACGAGGGGGCAGATGGACGACTTGGGGCGCACGCTGGGCAAGGGGCCGGCCATGACG
ATTCCGAACCCGCCATCTACCAGCGCCCACAACGACCTTGTGGACTTTGATTTCTACGGCACCGGGGCAACGAAT
GCCGCCGGCTGCAAGGCGCAGCAGATCACCAACCCACACGAGAAATGCTGGGGCGGCAAGCAATCCGCCTATGCA
AAATTGGACTTCGAAAAGGACTCGACGCTTGTCGGTGACGTACTGCAAAGCCTGAAGAAGGTCTCGCAGCGTGAA
CTGCAGACGACACTGGTGCTGTTGCCCTCGACGGCAAACTCGGGCTCGTGGTCGGACCGGTCCCGAGAGCTGCGG
CGCCGGCAGGCGGAGCAGGTCATGACCTCGGTGGACCAGGCGGCGCAAGCAGCTGTGACGAACACGGCGCAGAAC
GCGTACGTGTTGGCGCCCGCGCAGCGCATCCTGTCGTGCTTCCCCAACGAGAACGAATGCGCCAGCACGACGAAC
AACTGCTCGGGCCACGGGTCGTGCATGGACAAGTATGCCAAGGAGGACGGGTCGACCAGCAAGGACGCCTGCTTC
GTCTGCCACTGCCTGAGCACCCGCAGCGAGTCCGGCAGCCTGACGCACTGGGCCGGGCAGACGTGTGCGAAGAAG
GACGTGAGCGTTGCCTTTTGGCTCTTTGCCGGCTTCACCCTTGCCCTGGTCGGCATCGTGTGGCTGGCGATCTCG
ATGCTGTTGAACGTCGGCCAGGAGAAGCTTCCAGGCGTCATCGGTGCGGGCGTCTCGCGGTCCAGATAG
Gene >Hirsu2|1289
ATGAAGCTGAACGCCGGGCTCGTTGCGGCCTCTTGCGGCCTCGCCCTGGCCTCGCAGCCAGCGGCCGAGGTCTAC
CTCCTGCCGGCCCGCGAGGCCTCGTCGACGGCGACGTCTCTGCCCGCCGCCCTGGCGCGCCTGGTGCTGCTGCAG
CGGCTGGCGCCCACCGACCAGGGCCCTTCGTCCAGCGACTTCCCCAAGGACACGAGCGTCGAAGAGGTCGTTTCC
GCGCTCAACCGGTTCGGGAAGTCTACCCCGCCGCTGTTCGCCGACGGCGACGACAAGGCGCCCAGCCAGCTCGTC
GTGATGCTGGAGGGCATGACGAGGGGGCAGATGGACGACTTGGGGCGCACGCTGGGCAAGGGGCCGGCCATGACG
ATTCCGAACCCGCCATCTACCAGCGCCCACAACGACCTTGTGGACTTTGATTTCTACGGCACCGGGGCAACGAAT
GCCGCCGGCTGCAAGGCGCAGCAGATCACCAACCCACACGAGAAATGCTGGGGCGGCAAGCAATCCGCCTATGCA
AAATTGGACTTCGAAAAGGTAGGCTCGAGCATGGGTACCAACAATGCGTGGGGCTGACGAGATGGTGGTCGGCAG
GACTCGACGCTTGTCGGTGACGTACTGCAAAGCCTGAAGAAGGTCTCGCAGCGTGAACTGCAGACGACACTGGTG
CTGTTGCCCTCGACGGCAAACTCGGGCTCGTGGTCGGACCGGTCCCGAGAGCTGCGGCGCCGGCAGGCGGAGCAG
GTCATGACCTCGGTGGACCAGGCGGCGCAAGCAGCTGTGACGAACACGGCGCAGAACGCGTACGTGTTGGCGCCC
GCGCAGCGCATCCTGTCGTGCTTCCCCAACGAGAACGAATGCGCCAGCACGACGAACAACTGCTCGGGCCACGGG
TCGTGCATGGACAAGTATGCCAAGGAGGACGGGTCGACCAGCAAGGACGCCTGCTTCGTCTGCCACTGCCTGAGC
ACCCGCAGCGAGTCCGGCAGCCTGACGCACTGGGCCGGGCAGACGTGTGCGAAGAAGGACGTGAGCGTTGCCTTT
TGGCTCTTTGCCGGCTTCACCCTTGCCCTGGTCGGCATCGTGTGGCTGGCGATCTCGATGCTGTTGAACGTCGGC
CAGGAGAAGCTTCCAGGCGTCATCGGTGCGGGCGTCTCGCGGTCCAGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail