Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1281
Gene name
LocationContig_128:27565..28018
Strand-
Gene length (bp)453
Transcript length (bp)453
Coding sequence length (bp)453
Protein length (aa) 151

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07543 PGA2 Protein trafficking PGA2 2.0E-35 29 149

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53903|PGA2_YEAST Processing of GAS1 and ALP protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PGA2 PE=1 SV=3 41 150 4.0E-09
sp|Q9P6S6|PGA2_SCHPO PGA2-homolog C27.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC27.01c PE=1 SV=1 39 150 5.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 42 61 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1281
MEQQAREPELNALGMLVARLAEYGHNASHNIQDGFAKMTVRSWLRIVMIIGGYMLLRPYLLKFATKKAVQQLEKE
DAKSRGNDKMTPNEFRGIKEKLYEAPDDEGDGTSADWGSKARMRQRQMLKNLLEEEERRRAAENEDADIQEFLED
*
Coding >Hirsu2|1281
ATGGAGCAGCAAGCCCGGGAGCCGGAACTCAATGCCCTCGGCATGCTGGTTGCTCGTCTCGCCGAATACGGCCAC
AATGCCTCACACAATATCCAGGACGGCTTCGCCAAGATGACTGTTCGGTCGTGGCTTCGCATCGTGATGATCATC
GGCGGATACATGCTGCTGCGGCCGTATCTTCTGAAATTCGCCACCAAGAAGGCCGTGCAGCAGTTGGAGAAGGAA
GATGCCAAGTCTCGAGGCAACGACAAAATGACGCCCAACGAATTCCGCGGCATCAAGGAGAAGCTCTACGAGGCG
CCGGACGACGAAGGGGACGGTACCAGTGCGGATTGGGGCAGCAAGGCTAGGATGAGGCAGCGACAGATGCTCAAG
AACCTACTCGAGGAGGAGGAGAGGCGGCGCGCCGCGGAGAACGAGGACGCGGACATCCAGGAGTTCCTCGAGGAC
TAG
Transcript >Hirsu2|1281
ATGGAGCAGCAAGCCCGGGAGCCGGAACTCAATGCCCTCGGCATGCTGGTTGCTCGTCTCGCCGAATACGGCCAC
AATGCCTCACACAATATCCAGGACGGCTTCGCCAAGATGACTGTTCGGTCGTGGCTTCGCATCGTGATGATCATC
GGCGGATACATGCTGCTGCGGCCGTATCTTCTGAAATTCGCCACCAAGAAGGCCGTGCAGCAGTTGGAGAAGGAA
GATGCCAAGTCTCGAGGCAACGACAAAATGACGCCCAACGAATTCCGCGGCATCAAGGAGAAGCTCTACGAGGCG
CCGGACGACGAAGGGGACGGTACCAGTGCGGATTGGGGCAGCAAGGCTAGGATGAGGCAGCGACAGATGCTCAAG
AACCTACTCGAGGAGGAGGAGAGGCGGCGCGCCGCGGAGAACGAGGACGCGGACATCCAGGAGTTCCTCGAGGAC
TAG
Gene >Hirsu2|1281
ATGGAGCAGCAAGCCCGGGAGCCGGAACTCAATGCCCTCGGCATGCTGGTTGCTCGTCTCGCCGAATACGGCCAC
AATGCCTCACACAATATCCAGGACGGCTTCGCCAAGATGACTGTTCGGTCGTGGCTTCGCATCGTGATGATCATC
GGCGGATACATGCTGCTGCGGCCGTATCTTCTGAAATTCGCCACCAAGAAGGCCGTGCAGCAGTTGGAGAAGGAA
GATGCCAAGTCTCGAGGCAACGACAAAATGACGCCCAACGAATTCCGCGGCATCAAGGAGAAGCTCTACGAGGCG
CCGGACGACGAAGGGGACGGTACCAGTGCGGATTGGGGCAGCAAGGCTAGGATGAGGCAGCGACAGATGCTCAAG
AACCTACTCGAGGAGGAGGAGAGGCGGCGCGCCGCGGAGAACGAGGACGCGGACATCCAGGAGTTCCTCGAGGAC
TAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail