Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|128
Gene name
LocationContig_102:16513..19310
Strand+
Gene length (bp)2797
Transcript length (bp)2742
Coding sequence length (bp)2742
Protein length (aa) 914

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7086 0.5037 0.28 0.1574 0.3729 0.1538 0.0382 0.1837 0.0971 0.041

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7491
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|128 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|128
MAHADITIGASSLTRTLQGVEAATKGPRHAVEPVLQWLRSPPCPETAAAAGLSGQSAQEGPRQLSLDDWQQAIAT
ELSARDDMSRRLFNLALALSFLRERGRRKLSVSGHDLSRCWALVRGALTDNGPAGDLFAVSRNSQGFLTVPLCSL
SSSQGDIDELFRLHVWLPDQRRGNPDFALHSHQCFGQSWILAGEGEDFVYDVQEAESPAEATHAEYALAWSDGKS
LDSTYKVHSASSVVKRTGRLVKATATQSTVYTRDSSYTIAANVTHRSQVRPRAFHATLFFFDSRRGFVRGAAVLG
PKDLDAVTHHRTEPDSTPRMLARQVDDARTWELLMEQGRSHARRTDWEHALREFDRALSLCQSSQSLPNTAHFRH
LTLGELGSTNRRFGRYGTAKDILEKVIAEMDPSAHQVEFQGELGVSYRHMNRLEDAKAAFESQYRTAERLGLEWQ
MCRAIGNLGMVNFQLSQQHRDERLLDTAIRQLEQRVETARSLRAQTERQQGQGTALESPLKTWEVIGLGRLSLCH
YARGNAEEAISTSLAALEITRDSPDATVRAMTRFFYGRALLLQGRRMEALSLFNVPGTCSPAIALAKEPSEEHRA
YLKELVDIGADMNIVDQEGYTALDHAVFNGDSDTEALVLDGLRKNAAQKIELQLTDSRLRKQYRELFQEHMRPVL
LGGGPDCLQQLRRAYAQALASDESKRQVFDSLKFVPWRHFAALGRLPGRVDGIVVEWQPPRDTEPCERSADFLIF
ISYRWMKKATDATSPDDEQHSQYLRMRRAVEELLRLHPSIDERRVGIWADYACIDQADPSTGVGALPLIVAQCNA
IVSLVDDEYYDRAWCLVEVLMAQTLRRSYGLHLWYEQVDRPGESGELLSGWGLREGKGREVSIENKGVTYEEDRP
KVMFLERQSRLLG*
Coding >Hirsu2|128
ATGGCTCATGCAGACATCACCATCGGAGCCTCCTCTCTCACTCGGACCCTTCAAGGAGTCGAGGCAGCGACGAAG
GGCCCCCGTCATGCTGTCGAGCCGGTCCTCCAGTGGCTCCGGTCGCCGCCCTGCCCAGAGACCGCCGCCGCTGCG
GGCCTGAGTGGGCAGAGCGCCCAAGAGGGCCCGCGTCAGCTGTCGCTGGACGACTGGCAGCAGGCCATCGCCACC
GAGTTGAGTGCCAGAGACGACATGTCCCGTCGGCTCTTCAACCTCGCCCTCGCCCTCTCCTTTCTGCGCGAGCGG
GGCCGGCGGAAGCTCTCGGTCTCCGGTCACGACCTCTCCCGTTGCTGGGCGCTCGTCCGGGGCGCCTTGACGGAC
AACGGGCCGGCGGGGGACCTGTTTGCCGTTTCGCGCAATTCCCAGGGCTTCTTGACGGTTCCGCTCTGTAGTCTT
TCCTCGTCTCAGGGCGACATCGACGAGCTGTTCCGTCTCCACGTTTGGCTGCCGGACCAGAGGCGCGGAAATCCC
GACTTTGCCCTGCACTCGCATCAGTGCTTCGGCCAGAGCTGGATCCTGGCTGGGGAAGGGGAGGACTTCGTCTAC
GATGTCCAAGAGGCTGAAAGTCCGGCCGAGGCGACGCACGCCGAGTATGCCCTGGCGTGGAGCGACGGCAAAAGC
CTCGACTCAACGTATAAAGTGCACTCGGCATCTTCTGTCGTCAAGAGGACCGGCAGGCTCGTCAAAGCCACCGCG
ACGCAAAGCACCGTCTATACCCGCGACTCGTCGTATACAATTGCGGCAAACGTCACTCACAGGTCTCAGGTCCGG
CCTCGAGCCTTTCACGCCACCCTCTTCTTCTTTGACTCTCGCCGGGGCTTCGTCCGAGGCGCCGCCGTGCTCGGC
CCCAAGGACTTAGACGCAGTCACCCACCACCGCACGGAGCCGGACTCGACACCCCGAATGTTGGCTCGGCAGGTG
GACGATGCTCGCACCTGGGAGCTGCTCATGGAGCAAGGCCGAAGTCATGCCCGGCGTACGGACTGGGAGCACGCC
CTCAGAGAGTTCGATCGCGCCCTCAGCCTGTGCCAGTCGAGTCAAAGCCTTCCCAATACCGCTCACTTCCGGCAC
TTGACCCTGGGAGAGCTAGGCAGCACCAACCGCCGATTCGGCCGCTACGGGACGGCCAAGGACATTCTCGAAAAA
GTCATTGCCGAAATGGACCCTAGTGCGCACCAGGTCGAGTTCCAAGGCGAGCTCGGCGTCTCGTATCGCCACATG
AACCGCCTAGAGGACGCCAAGGCAGCCTTCGAGAGCCAGTATCGGACTGCTGAGCGACTGGGCCTCGAGTGGCAG
ATGTGCAGAGCCATAGGAAATCTCGGCATGGTAAACTTCCAGCTATCCCAGCAGCATAGGGACGAGCGGCTGCTC
GATACGGCTATTCGCCAGCTCGAACAACGAGTCGAGACGGCCCGGAGCCTGCGTGCTCAGACCGAGAGACAGCAG
GGACAAGGCACGGCTTTGGAGAGCCCCCTCAAGACCTGGGAAGTCATCGGCCTCGGACGCCTGTCCCTGTGCCAT
TACGCCCGCGGCAACGCCGAGGAGGCAATCAGCACGTCCTTGGCCGCCCTCGAAATCACCCGAGACTCGCCCGAC
GCGACTGTACGGGCCATGACGCGCTTCTTCTACGGCCGCGCCTTGCTCCTGCAGGGCCGCCGCATGGAGGCCCTC
AGCCTGTTCAACGTGCCGGGGACGTGCAGTCCCGCCATCGCGCTCGCCAAAGAACCGTCCGAGGAACACCGGGCG
TACCTCAAGGAGCTTGTCGACATCGGTGCCGACATGAACATCGTCGATCAGGAGGGCTACACGGCGCTCGACCAT
GCCGTCTTCAACGGCGACTCCGACACTGAAGCCCTGGTCCTCGACGGACTGAGGAAGAACGCCGCGCAGAAGATA
GAGCTGCAGCTGACGGATTCGCGCCTTCGAAAACAGTACCGCGAGCTGTTCCAGGAGCACATGAGGCCCGTCCTG
CTGGGCGGGGGACCGGACTGCCTGCAACAGTTGAGGCGGGCATACGCCCAGGCTCTCGCCTCCGACGAGTCCAAG
AGACAGGTCTTCGACAGCCTCAAGTTCGTGCCGTGGCGCCACTTCGCGGCCCTCGGAAGACTGCCCGGGCGTGTC
GACGGGATAGTCGTGGAGTGGCAGCCACCGCGGGACACGGAGCCATGCGAGCGGTCCGCCGACTTCCTCATCTTC
ATCTCGTACCGCTGGATGAAGAAGGCAACAGACGCCACGTCGCCGGATGACGAGCAGCACTCGCAGTACCTGCGG
ATGAGGCGCGCGGTGGAGGAGCTCCTGCGACTCCACCCGTCCATCGACGAGCGGCGAGTGGGCATCTGGGCGGAC
TACGCGTGCATCGACCAGGCAGATCCCAGCACCGGGGTCGGCGCCCTCCCGCTCATCGTCGCCCAGTGCAACGCC
ATCGTCAGCCTCGTCGACGACGAGTACTACGACCGCGCCTGGTGCTTGGTCGAAGTCCTGATGGCCCAGACGCTG
AGGCGGTCGTATGGACTGCACTTGTGGTACGAGCAGGTGGACCGGCCCGGCGAGTCCGGCGAGCTGCTAAGTGGA
TGGGGGCTCCGAGAGGGCAAGGGTCGCGAGGTGAGCATCGAGAACAAGGGGGTCACGTATGAAGAGGACCGGCCC
AAGGTCATGTTCTTGGAGAGGCAGAGCAGGCTCTTGGGGTGA
Transcript >Hirsu2|128
ATGGCTCATGCAGACATCACCATCGGAGCCTCCTCTCTCACTCGGACCCTTCAAGGAGTCGAGGCAGCGACGAAG
GGCCCCCGTCATGCTGTCGAGCCGGTCCTCCAGTGGCTCCGGTCGCCGCCCTGCCCAGAGACCGCCGCCGCTGCG
GGCCTGAGTGGGCAGAGCGCCCAAGAGGGCCCGCGTCAGCTGTCGCTGGACGACTGGCAGCAGGCCATCGCCACC
GAGTTGAGTGCCAGAGACGACATGTCCCGTCGGCTCTTCAACCTCGCCCTCGCCCTCTCCTTTCTGCGCGAGCGG
GGCCGGCGGAAGCTCTCGGTCTCCGGTCACGACCTCTCCCGTTGCTGGGCGCTCGTCCGGGGCGCCTTGACGGAC
AACGGGCCGGCGGGGGACCTGTTTGCCGTTTCGCGCAATTCCCAGGGCTTCTTGACGGTTCCGCTCTGTAGTCTT
TCCTCGTCTCAGGGCGACATCGACGAGCTGTTCCGTCTCCACGTTTGGCTGCCGGACCAGAGGCGCGGAAATCCC
GACTTTGCCCTGCACTCGCATCAGTGCTTCGGCCAGAGCTGGATCCTGGCTGGGGAAGGGGAGGACTTCGTCTAC
GATGTCCAAGAGGCTGAAAGTCCGGCCGAGGCGACGCACGCCGAGTATGCCCTGGCGTGGAGCGACGGCAAAAGC
CTCGACTCAACGTATAAAGTGCACTCGGCATCTTCTGTCGTCAAGAGGACCGGCAGGCTCGTCAAAGCCACCGCG
ACGCAAAGCACCGTCTATACCCGCGACTCGTCGTATACAATTGCGGCAAACGTCACTCACAGGTCTCAGGTCCGG
CCTCGAGCCTTTCACGCCACCCTCTTCTTCTTTGACTCTCGCCGGGGCTTCGTCCGAGGCGCCGCCGTGCTCGGC
CCCAAGGACTTAGACGCAGTCACCCACCACCGCACGGAGCCGGACTCGACACCCCGAATGTTGGCTCGGCAGGTG
GACGATGCTCGCACCTGGGAGCTGCTCATGGAGCAAGGCCGAAGTCATGCCCGGCGTACGGACTGGGAGCACGCC
CTCAGAGAGTTCGATCGCGCCCTCAGCCTGTGCCAGTCGAGTCAAAGCCTTCCCAATACCGCTCACTTCCGGCAC
TTGACCCTGGGAGAGCTAGGCAGCACCAACCGCCGATTCGGCCGCTACGGGACGGCCAAGGACATTCTCGAAAAA
GTCATTGCCGAAATGGACCCTAGTGCGCACCAGGTCGAGTTCCAAGGCGAGCTCGGCGTCTCGTATCGCCACATG
AACCGCCTAGAGGACGCCAAGGCAGCCTTCGAGAGCCAGTATCGGACTGCTGAGCGACTGGGCCTCGAGTGGCAG
ATGTGCAGAGCCATAGGAAATCTCGGCATGGTAAACTTCCAGCTATCCCAGCAGCATAGGGACGAGCGGCTGCTC
GATACGGCTATTCGCCAGCTCGAACAACGAGTCGAGACGGCCCGGAGCCTGCGTGCTCAGACCGAGAGACAGCAG
GGACAAGGCACGGCTTTGGAGAGCCCCCTCAAGACCTGGGAAGTCATCGGCCTCGGACGCCTGTCCCTGTGCCAT
TACGCCCGCGGCAACGCCGAGGAGGCAATCAGCACGTCCTTGGCCGCCCTCGAAATCACCCGAGACTCGCCCGAC
GCGACTGTACGGGCCATGACGCGCTTCTTCTACGGCCGCGCCTTGCTCCTGCAGGGCCGCCGCATGGAGGCCCTC
AGCCTGTTCAACGTGCCGGGGACGTGCAGTCCCGCCATCGCGCTCGCCAAAGAACCGTCCGAGGAACACCGGGCG
TACCTCAAGGAGCTTGTCGACATCGGTGCCGACATGAACATCGTCGATCAGGAGGGCTACACGGCGCTCGACCAT
GCCGTCTTCAACGGCGACTCCGACACTGAAGCCCTGGTCCTCGACGGACTGAGGAAGAACGCCGCGCAGAAGATA
GAGCTGCAGCTGACGGATTCGCGCCTTCGAAAACAGTACCGCGAGCTGTTCCAGGAGCACATGAGGCCCGTCCTG
CTGGGCGGGGGACCGGACTGCCTGCAACAGTTGAGGCGGGCATACGCCCAGGCTCTCGCCTCCGACGAGTCCAAG
AGACAGGTCTTCGACAGCCTCAAGTTCGTGCCGTGGCGCCACTTCGCGGCCCTCGGAAGACTGCCCGGGCGTGTC
GACGGGATAGTCGTGGAGTGGCAGCCACCGCGGGACACGGAGCCATGCGAGCGGTCCGCCGACTTCCTCATCTTC
ATCTCGTACCGCTGGATGAAGAAGGCAACAGACGCCACGTCGCCGGATGACGAGCAGCACTCGCAGTACCTGCGG
ATGAGGCGCGCGGTGGAGGAGCTCCTGCGACTCCACCCGTCCATCGACGAGCGGCGAGTGGGCATCTGGGCGGAC
TACGCGTGCATCGACCAGGCAGATCCCAGCACCGGGGTCGGCGCCCTCCCGCTCATCGTCGCCCAGTGCAACGCC
ATCGTCAGCCTCGTCGACGACGAGTACTACGACCGCGCCTGGTGCTTGGTCGAAGTCCTGATGGCCCAGACGCTG
AGGCGGTCGTATGGACTGCACTTGTGGTACGAGCAGGTGGACCGGCCCGGCGAGTCCGGCGAGCTGCTAAGTGGA
TGGGGGCTCCGAGAGGGCAAGGGTCGCGAGGTGAGCATCGAGAACAAGGGGGTCACGTATGAAGAGGACCGGCCC
AAGGTCATGTTCTTGGAGAGGCAGAGCAGGCTCTTGGGGTGA
Gene >Hirsu2|128
ATGGCTCATGCAGACATCACCATCGGAGCCTCCTCTCTCACTCGGACCCTTCAAGGAGTCGAGGCAGCGACGAAG
GGCCCCCGTCATGCTGTCGAGCCGGTCCTCCAGTGGCTCCGGTCGCCGCCCTGCCCAGAGACCGCCGCCGCTGCG
GGCCTGAGTGGGCAGAGCGCCCAAGAGGGCCCGCGTCAGCTGTCGCTGGACGACTGGCAGCAGGCCATCGCCACC
GAGTTGAGTGCCAGAGACGACATGTCCCGTCGGCTCTTCAACCTCGCCCTCGCCCTCTCCTTTCTGCGCGAGCGG
GGCCGGCGGAAGCTCTCGGTCTCCGGTCACGACCTCTCCCGTTGCTGGGCGCTCGTCCGGGGCGCCTTGACGGAC
AACGGGCCGGCGGGGGACCTGTTTGCCGTTTCGCGCAATTCCCAGGGCTTCTTGACGGTTCCGCTCTGTAGTCTT
TCCTCGTCTCAGGGCGACATCGACGAGCTGTTCCGTCTCCACGTTTGGCTGCCGGACCAGAGGCGCGGAAATCCC
GACTTTGCCCTGCACTCGCATCAGTGCTTCGGCCAGAGCTGGATCCTGGCTGGGGAAGGGGAGGACTTCGTCTAC
GATGTCCAAGAGGCTGAAAGTCCGGCCGAGGCGACGCACGCCGAGTATGCCCTGGCGTGGAGCGACGGCAAAAGC
CTCGACTCAACGTATAAAGTGCACTCGGCATCTTCTGTCGTCAAGAGGACCGGCAGGCTCGTCAAAGCCACCGCG
ACGCAAAGCACCGTCTATACCCGCGACTCGTCGTATACAATTGCGGCAAACGTCACTCACAGGTCTCAGGTCCGG
CCTCGAGCCTTTCACGCCACCCTCTTCTTCTTTGACTCTCGCCGGGGCTTCGTCCGAGGCGCCGCCGTGCTCGGC
CCCAAGGACTTAGACGCAGTCACCCACCACCGCACGGAGCCGGACTCGACACCCCGAATGTTGGCTCGGCAGGTG
GACGATGCTCGCACCTGGGAGCTGCTCATGGAGCAAGGCCGAAGTCATGCCCGGCGTACGGACTGGGAGCACGCC
CTCAGAGAGTTCGATCGCGCCCTCAGCCTGTGCCAGTCGAGTCAAAGCCTTCCCAATACCGCTCACTTCCGGCAC
TTGACCCTGGGAGAGCTAGGCAGCACCAACCGCCGATTCGGCCGCTACGGGACGGCCAAGGACATTCTCGAAAAA
GTCATTGCCGAAATGGACCCTAGTGCGCACCAGGTCGAGTTCCAAGGCGAGCTCGGCGTCTCGTATCGCCACATG
AACCGCCTAGAGGACGCCAAGGCAGCCTTCGAGAGCCAGTATCGGACTGCTGAGCGACTGGGCCTCGAGTGGCAG
ATGTGCAGAGCCATAGGAAATCTCGGCATGGTAAACTTCCAGCTATCCCAGCAGCATAGGGACGAGCGGCTGCTC
GATACGGCTATTCGCCAGCTCGAACAACGAGTCGAGACGGCCCGGAGCCTGCGTGCTCAGACCGAGAGACAGCAG
GGACAAGGCACGGCTTTGGAGAGCCCCCTCAAGACCTGGGAAGTCATCGGCCTCGGACGCCTGTCCCTGTGCCAT
TACGCCCGCGGCAACGCCGAGGAGGCAATCAGCACGTCCTTGGCCGCCCTCGAAATCACCCGAGACTCGCCCGAC
GCGACTGTACGGGCCATGACGCGCTTCTTCTACGGCCGCGCCTTGCTCCTGCAGGGCCGCCGCATGGAGGCCCTC
AGCCTGTTCAACGTGCCGGGGACGTGCAGTCCCGCCATCGCGCTCGCCAAAGAACCGTCCGAGGAACACCGGGCG
TACCTCAAGGAGCTTGTCGACATCGGTGCCGACATGAACATCGTCGATCAGGAGGGCTACACGGCGCTCGACCAT
GCCGTCTTCAACGGCGACTCCGACACTGAAGCCCTGGTCCTCGACGGACTGAGGAAGAACGCCGCGCAGAAGATA
GAGCTGCAGCTGACGGATTCGCGCCTTCGAAAACAGTACCGCGAGCTGTTCCAGGAGCACATGAGGCCCGTCCTG
CTGGGCGGGGGACCGGACTGCCTGCAACAGTTGAGGCGGGCATACGCCCAGGCTCTCGCCTCCGACGAGTCCAAG
AGACAGGTCTTCGACAGCCTCAAGTTCGTGCCGTGGCGCCACTTCGCGGCCCTCGGAAGACTGCCCGGGCGTGTC
GACGGGATAGTCGTGGAGTGGCAGCCACCGCGGGACACGGAGCCATGCGAGCGGTCCGCCGACTTCCTCATCTTC
ATCTCGTACCGCTGGATGAAGAAGGCAACAGACGCCACGTCGCCGGATGACGAGCAGCACTCGCAGTACCTGCGG
ATGAGGCGCGCGGTGGAGGAGCTCCTGCGACTCCACCCGTCCATCGACGAGCGGCGAGTGGGCATCTGGGCGGTA
AGACAGCCTCGCCGGGGCCGAAGACGGCGAAGAAGCTGACGTATCCGACCAGGACTACGCGTGCATCGACCAGGC
AGATCCCAGCACCGGGGTCGGCGCCCTCCCGCTCATCGTCGCCCAGTGCAACGCCATCGTCAGCCTCGTCGACGA
CGAGTACTACGACCGCGCCTGGTGCTTGGTCGAAGTCCTGATGGCCCAGACGCTGAGGCGGTCGTATGGACTGCA
CTTGTGGTACGAGCAGGTGGACCGGCCCGGCGAGTCCGGCGAGCTGCTAAGTGGATGGGGGCTCCGAGAGGGCAA
GGGTCGCGAGGTGAGCATCGAGAACAAGGGGGTCACGTATGAAGAGGACCGGCCCAAGGTCATGTTCTTGGAGAG
GCAGAGCAGGCTCTTGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail