Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1274
Gene name
LocationContig_128:12249..16581
Strand-
Gene length (bp)4332
Transcript length (bp)4332
Coding sequence length (bp)4332
Protein length (aa) 1444

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02765 POT1 Telomeric single stranded DNA binding POT1/CDC13 1.5E-11 1290 1414

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0000723 telomere maintenance Yes
GO:0000784 nuclear chromosome, telomeric region Yes
GO:0005488 binding No
GO:0065007 biological regulation No
GO:0097159 organic cyclic compound binding No
GO:0006259 DNA metabolic process No
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:0051276 chromosome organization No
GO:0044428 nuclear part No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0042592 homeostatic process No
GO:0003674 molecular_function No
GO:0044422 organelle part No
GO:0098687 chromosomal region No
GO:0005575 cellular_component No
GO:0000781 chromosome, telomeric region No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0044424 intracellular part No
GO:0016043 cellular component organization No
GO:0071840 cellular component organization or biogenesis No
GO:0044427 chromosomal part No
GO:0044454 nuclear chromosome part No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006996 organelle organization No
GO:0060249 anatomical structure homeostasis No
GO:0044464 cell part No
GO:0065008 regulation of biological quality No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0032200 telomere organization No
GO:0044446 intracellular organelle part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1274
MADGRLAVEALRSTDATPIAKLHPDIENSQSRAVDGVVTITWPYSVVKESIAFVLAERDFRLRRQSGQLRVEFRG
PAAKALVDLRVGGGDEVRLSLDGATWDGDQAPTQLPAGALEWQLSFSNRLLLILRRADGQGSDAIDIHAPNDEDA
QAHEQLESSTDKRTPPPPDPPQVVASPNDDVPPSLAAKRQASSMLGPDEFASPAFIKRARVSYGSLFEGGLDIFD
EERGRETRDRKKRRSRFSMPGTSWKYSSRSPSPEASRSPSHGSVAADEARKRPEQEAASDAPKTSPHRPVMVDEA
CQTHDEFFSPSHVDVYVSAEARFSGSAMRPTSASAPPEAHHQLGHDTLQTPSRMLFDRGSEQHVLTRSAVEPSMG
YETTFAFGTEQHHEPAHLLSAPSMSNPAMSSASFSSQAMSAPDYHLATFGGHPSPSSALNIDPGLQFPNEMHAPD
HLYYGGPVPEDATWNPGPLPPAEPPISVQDGMHRPGVLADGSLVRGAASGAHPGPEDSERSVPARPPSRQNGRPE
SGGSVERAEEAASAAAAAADQDDVDGEDDDAEDIPGEDYDLRNYDRARDDDDEEDSEEESEPDSSDVERRAIDFS
EEDSQDEQERDEPDLELDGEARRDEGSSDSLNDSRDDDDDDGAEYASSDGEDELSAGAEHFDGYRGHYEASRDYD
EDDEDGYFERREFGDEGEESEEDDDGFGPTSVAADPVVISLLSDSEAEDSEPAEEESALRNPPPRHGEAGLERPD
EGTSADRARREAPSAQASPGGGHDAAGDGVGEQSAPKADRTPCQPTQSATSPEAPSDEPGVTSDKHGMPSERGGQ
NQPAKSPTKEKPRPEEEGRCEHTDSSSESPIAGGQPGVDQADPMDVDEAPVDETATASRAGQDTQLENELQASLI
QEDEPVDEPMEDESGSNEADPAVSESQPTEMEVERGVPSQASDALMRDVDEDESSEARRAERQTTVADVAGAVSE
GQQQAGAASMTETQRGTSGPTATEPAAAAEASEPRDSDEGTQQPMTPAQSQHKDNTCRAVPRSEGAPDEDEDEAA
EAQIISEYHERQAPTKPSASTADKASAGSKVASPDSSEVIDDDRPKGGQELEVQITVKPRKGRHRRTRSGGNSGR
GGAHADPSLVLAKAPTSEGSVPESEKELKPPTRLRVAGTKSDETDPSLRLATDVTHAKDDGSPRTPRAGRSAAVE
AERTTPSAVASTPTSASRRQRATPEVTRELRSRAHASPDVGAEAALESPSVAGSMAEDQDAAALKRNLQKSLRTS
LADFLPLKSLRESLNKTTDIVAVATLTPPQPHRPKHGPRDYMMELILTDPSTAPTSVIVAHLFRQHQASLPVVQA
GDVVLLRRVQVVSVQGRGFGVRVKDESAWAVFEKGDEEMLPQIKGPPVEVTAAEAEHAQGLRRWWAMQDERALAK
VDKAAHKASSQAGKNEAK*
Coding >Hirsu2|1274
ATGGCCGACGGTCGGCTGGCAGTGGAGGCGCTCCGTAGCACCGACGCCACACCCATCGCGAAGCTCCATCCGGAC
ATCGAAAATTCCCAGTCGCGAGCCGTCGACGGCGTCGTCACCATCACCTGGCCCTACAGCGTCGTCAAGGAGTCG
ATTGCCTTCGTCCTTGCCGAGCGCGACTTCCGCCTGCGGCGCCAGAGCGGACAGCTTCGCGTCGAGTTCCGCGGC
CCTGCAGCCAAGGCACTCGTCGACCTGCGCGTCGGCGGCGGCGACGAGGTCCGCCTCAGTTTGGACGGCGCCACG
TGGGACGGCGACCAAGCCCCGACGCAGCTCCCCGCCGGCGCCCTGGAGTGGCAGCTTAGCTTTTCCAACCGCCTG
CTGTTGATCCTTCGTCGGGCAGACGGCCAGGGCTCCGACGCGATAGATATCCATGCCCCCAACGACGAGGACGCG
CAGGCACACGAGCAGCTGGAATCCTCGACCGACAAACGTACCCCTCCCCCACCCGATCCCCCGCAAGTTGTCGCC
TCGCCCAACGACGATGTTCCGCCCTCGCTGGCCGCGAAGAGGCAAGCCTCGTCGATGTTGGGGCCCGACGAATTC
GCGTCTCCCGCCTTCATCAAACGCGCCAGGGTGTCATACGGGTCTTTATTCGAGGGCGGCCTCGACATTTTTGAT
GAGGAAAGGGGGAGGGAGACCAGGGATAGGAAGAAGCGGCGCTCGCGCTTCAGCATGCCGGGCACGTCGTGGAAA
TACAGCAGCCGGTCGCCAAGCCCCGAGGCGAGCCGGTCGCCAAGCCACGGCAGCGTCGCCGCCGACGAAGCGAGA
AAGAGGCCCGAACAGGAGGCGGCTTCAGATGCTCCCAAGACCTCGCCGCATCGACCAGTGATGGTCGATGAAGCA
TGCCAAACGCACGACGAGTTTTTCAGTCCGTCGCATGTGGACGTTTACGTCTCGGCCGAAGCGCGCTTCTCGGGT
TCTGCGATGCGACCGACATCGGCCTCGGCTCCTCCCGAGGCTCACCATCAACTTGGCCACGACACGCTCCAGACG
CCTTCGAGAATGCTCTTCGATCGCGGTTCGGAGCAGCACGTCCTGACGAGGTCGGCCGTGGAGCCCAGCATGGGT
TACGAAACGACCTTCGCCTTTGGGACGGAGCAACATCACGAGCCGGCGCACTTGCTCAGCGCACCGTCCATGTCC
AACCCGGCGATGAGCTCGGCGAGCTTTAGCAGTCAGGCCATGTCAGCCCCGGACTATCATCTTGCGACCTTTGGA
GGTCATCCCTCCCCGTCCTCAGCGCTCAATATCGACCCAGGCCTGCAGTTCCCCAACGAAATGCATGCGCCGGAT
CACTTGTATTATGGTGGCCCCGTGCCGGAAGACGCCACATGGAACCCTGGACCTCTTCCGCCCGCCGAGCCGCCC
ATTTCGGTTCAGGACGGCATGCACCGCCCCGGGGTCTTGGCGGATGGATCTCTCGTGAGGGGTGCGGCGTCCGGT
GCTCACCCAGGACCAGAGGATTCGGAAAGATCGGTGCCTGCCAGGCCCCCCTCCCGCCAAAACGGCAGACCCGAG
TCGGGCGGCTCAGTCGAGAGAGCCGAAGAAGCGGCGTCGGCGGCGGCGGCGGCGGCGGATCAAGACGACGTCGAT
GGCGAGGATGATGACGCCGAGGACATCCCAGGTGAAGACTACGACTTGAGGAACTACGACCGCGCCAGAGATGAC
GACGACGAGGAAGATTCAGAGGAGGAGTCGGAGCCCGACAGTAGTGATGTGGAGCGGCGAGCGATCGACTTCTCC
GAGGAAGACAGTCAAGACGAGCAGGAAAGAGACGAGCCAGACCTTGAGCTAGATGGTGAGGCCAGACGGGACGAG
GGATCCAGTGACAGTCTCAACGACAGCCGTGACGACGATGACGACGACGGCGCCGAGTATGCCAGCTCGGACGGC
GAAGACGAGTTGAGCGCCGGCGCAGAACACTTTGACGGCTATAGAGGACATTATGAGGCGTCGCGAGATTATGAT
GAGGACGACGAAGACGGGTACTTTGAGCGGCGCGAATTCGGGGATGAAGGAGAAGAGTCCGAAGAAGACGACGAT
GGTTTCGGCCCCACATCAGTTGCTGCGGACCCTGTGGTTATCAGCCTCCTTTCGGACTCCGAGGCCGAGGACTCC
GAGCCGGCCGAGGAGGAATCTGCCCTCAGAAATCCCCCCCCGCGGCACGGAGAGGCGGGCCTCGAACGGCCGGAC
GAGGGAACTTCGGCCGACCGCGCACGAAGAGAGGCGCCGTCGGCCCAGGCCAGTCCAGGCGGTGGACACGATGCT
GCTGGGGATGGCGTTGGCGAACAATCGGCCCCCAAAGCCGACCGCACACCCTGCCAACCTACGCAAAGTGCTACT
TCCCCTGAGGCGCCAAGCGACGAGCCTGGAGTGACGAGTGACAAGCACGGAATGCCGAGCGAGAGAGGCGGTCAG
AACCAACCCGCCAAGTCCCCGACGAAAGAAAAGCCAAGGCCCGAGGAGGAAGGACGATGTGAGCACACGGACAGC
AGCAGCGAGTCACCGATTGCCGGTGGCCAGCCTGGTGTCGATCAGGCGGACCCGATGGACGTTGATGAAGCCCCG
GTCGACGAGACAGCAACCGCGTCACGGGCCGGCCAAGATACGCAACTCGAAAATGAACTGCAGGCATCCCTCATA
CAGGAAGACGAGCCTGTGGATGAGCCCATGGAAGACGAGTCAGGGAGCAACGAGGCGGATCCTGCCGTTTCCGAA
TCCCAGCCTACGGAAATGGAAGTCGAGCGTGGAGTGCCTTCTCAGGCCTCGGACGCCTTGATGCGGGATGTTGAC
GAGGACGAGTCGTCCGAGGCTCGTCGAGCTGAACGGCAGACTACGGTTGCAGATGTGGCCGGGGCGGTCTCCGAG
GGCCAGCAGCAGGCCGGCGCGGCGTCGATGACGGAAACTCAGCGAGGTACCTCGGGGCCCACAGCCACGGAGCCC
GCAGCCGCGGCGGAAGCTTCGGAACCGAGGGACTCGGATGAAGGCACTCAGCAGCCGATGACGCCGGCTCAGTCC
CAACACAAGGACAACACTTGTCGCGCGGTGCCCCGGTCAGAGGGCGCCCCGGACGAGGACGAAGATGAGGCGGCA
GAGGCCCAGATCATTTCAGAGTACCACGAACGTCAGGCGCCTACAAAGCCGTCGGCGAGTACGGCAGATAAGGCG
AGTGCCGGATCGAAAGTGGCATCGCCCGACTCAAGCGAGGTCATAGACGATGATCGGCCCAAGGGCGGCCAGGAA
CTGGAGGTCCAGATCACGGTCAAGCCGCGTAAGGGCCGGCACCGGAGGACCAGGTCTGGCGGCAATAGCGGACGC
GGCGGGGCGCACGCGGACCCCAGCCTCGTCCTGGCCAAGGCGCCGACCTCCGAGGGTTCGGTGCCCGAGTCGGAG
AAGGAGCTCAAACCACCGACGAGGCTGCGAGTGGCCGGCACGAAGAGCGACGAGACGGATCCGAGCCTGCGCCTG
GCAACGGATGTAACTCATGCGAAAGACGATGGCTCGCCGCGGACGCCACGTGCCGGACGCAGCGCGGCGGTGGAA
GCGGAGCGGACGACGCCGTCGGCCGTGGCGTCGACTCCGACGTCGGCGAGCAGACGGCAACGAGCCACGCCGGAA
GTGACTCGGGAACTACGCAGCAGGGCGCACGCCAGTCCGGATGTCGGGGCCGAGGCGGCGTTGGAGTCGCCGTCG
GTGGCCGGCTCGATGGCGGAAGACCAGGACGCGGCGGCGCTGAAACGGAATCTGCAGAAGTCGCTGCGGACGTCG
CTGGCCGACTTCTTGCCGCTCAAGTCGCTGCGGGAGTCGCTCAACAAGACGACGGACATAGTGGCGGTGGCGACG
CTGACGCCGCCGCAGCCGCACCGGCCCAAGCACGGCCCACGCGACTACATGATGGAGCTGATCCTCACGGACCCG
TCGACGGCGCCGACGAGCGTCATCGTGGCTCACCTGTTCCGGCAGCACCAGGCGTCGCTGCCGGTGGTGCAGGCG
GGAGACGTCGTGCTCCTGCGTCGGGTGCAGGTCGTCTCGGTGCAGGGCCGCGGGTTCGGCGTGCGGGTCAAGGAC
GAGTCGGCGTGGGCGGTGTTCGAGAAGGGGGACGAGGAGATGCTGCCGCAGATCAAGGGCCCGCCGGTGGAGGTG
ACGGCGGCCGAGGCCGAGCACGCGCAGGGGCTCAGGCGGTGGTGGGCGATGCAGGACGAAAGGGCCTTGGCCAAG
GTCGATAAGGCGGCCCACAAGGCATCGTCGCAGGCCGGCAAGAACGAGGCAAAGTGA
Transcript >Hirsu2|1274
ATGGCCGACGGTCGGCTGGCAGTGGAGGCGCTCCGTAGCACCGACGCCACACCCATCGCGAAGCTCCATCCGGAC
ATCGAAAATTCCCAGTCGCGAGCCGTCGACGGCGTCGTCACCATCACCTGGCCCTACAGCGTCGTCAAGGAGTCG
ATTGCCTTCGTCCTTGCCGAGCGCGACTTCCGCCTGCGGCGCCAGAGCGGACAGCTTCGCGTCGAGTTCCGCGGC
CCTGCAGCCAAGGCACTCGTCGACCTGCGCGTCGGCGGCGGCGACGAGGTCCGCCTCAGTTTGGACGGCGCCACG
TGGGACGGCGACCAAGCCCCGACGCAGCTCCCCGCCGGCGCCCTGGAGTGGCAGCTTAGCTTTTCCAACCGCCTG
CTGTTGATCCTTCGTCGGGCAGACGGCCAGGGCTCCGACGCGATAGATATCCATGCCCCCAACGACGAGGACGCG
CAGGCACACGAGCAGCTGGAATCCTCGACCGACAAACGTACCCCTCCCCCACCCGATCCCCCGCAAGTTGTCGCC
TCGCCCAACGACGATGTTCCGCCCTCGCTGGCCGCGAAGAGGCAAGCCTCGTCGATGTTGGGGCCCGACGAATTC
GCGTCTCCCGCCTTCATCAAACGCGCCAGGGTGTCATACGGGTCTTTATTCGAGGGCGGCCTCGACATTTTTGAT
GAGGAAAGGGGGAGGGAGACCAGGGATAGGAAGAAGCGGCGCTCGCGCTTCAGCATGCCGGGCACGTCGTGGAAA
TACAGCAGCCGGTCGCCAAGCCCCGAGGCGAGCCGGTCGCCAAGCCACGGCAGCGTCGCCGCCGACGAAGCGAGA
AAGAGGCCCGAACAGGAGGCGGCTTCAGATGCTCCCAAGACCTCGCCGCATCGACCAGTGATGGTCGATGAAGCA
TGCCAAACGCACGACGAGTTTTTCAGTCCGTCGCATGTGGACGTTTACGTCTCGGCCGAAGCGCGCTTCTCGGGT
TCTGCGATGCGACCGACATCGGCCTCGGCTCCTCCCGAGGCTCACCATCAACTTGGCCACGACACGCTCCAGACG
CCTTCGAGAATGCTCTTCGATCGCGGTTCGGAGCAGCACGTCCTGACGAGGTCGGCCGTGGAGCCCAGCATGGGT
TACGAAACGACCTTCGCCTTTGGGACGGAGCAACATCACGAGCCGGCGCACTTGCTCAGCGCACCGTCCATGTCC
AACCCGGCGATGAGCTCGGCGAGCTTTAGCAGTCAGGCCATGTCAGCCCCGGACTATCATCTTGCGACCTTTGGA
GGTCATCCCTCCCCGTCCTCAGCGCTCAATATCGACCCAGGCCTGCAGTTCCCCAACGAAATGCATGCGCCGGAT
CACTTGTATTATGGTGGCCCCGTGCCGGAAGACGCCACATGGAACCCTGGACCTCTTCCGCCCGCCGAGCCGCCC
ATTTCGGTTCAGGACGGCATGCACCGCCCCGGGGTCTTGGCGGATGGATCTCTCGTGAGGGGTGCGGCGTCCGGT
GCTCACCCAGGACCAGAGGATTCGGAAAGATCGGTGCCTGCCAGGCCCCCCTCCCGCCAAAACGGCAGACCCGAG
TCGGGCGGCTCAGTCGAGAGAGCCGAAGAAGCGGCGTCGGCGGCGGCGGCGGCGGCGGATCAAGACGACGTCGAT
GGCGAGGATGATGACGCCGAGGACATCCCAGGTGAAGACTACGACTTGAGGAACTACGACCGCGCCAGAGATGAC
GACGACGAGGAAGATTCAGAGGAGGAGTCGGAGCCCGACAGTAGTGATGTGGAGCGGCGAGCGATCGACTTCTCC
GAGGAAGACAGTCAAGACGAGCAGGAAAGAGACGAGCCAGACCTTGAGCTAGATGGTGAGGCCAGACGGGACGAG
GGATCCAGTGACAGTCTCAACGACAGCCGTGACGACGATGACGACGACGGCGCCGAGTATGCCAGCTCGGACGGC
GAAGACGAGTTGAGCGCCGGCGCAGAACACTTTGACGGCTATAGAGGACATTATGAGGCGTCGCGAGATTATGAT
GAGGACGACGAAGACGGGTACTTTGAGCGGCGCGAATTCGGGGATGAAGGAGAAGAGTCCGAAGAAGACGACGAT
GGTTTCGGCCCCACATCAGTTGCTGCGGACCCTGTGGTTATCAGCCTCCTTTCGGACTCCGAGGCCGAGGACTCC
GAGCCGGCCGAGGAGGAATCTGCCCTCAGAAATCCCCCCCCGCGGCACGGAGAGGCGGGCCTCGAACGGCCGGAC
GAGGGAACTTCGGCCGACCGCGCACGAAGAGAGGCGCCGTCGGCCCAGGCCAGTCCAGGCGGTGGACACGATGCT
GCTGGGGATGGCGTTGGCGAACAATCGGCCCCCAAAGCCGACCGCACACCCTGCCAACCTACGCAAAGTGCTACT
TCCCCTGAGGCGCCAAGCGACGAGCCTGGAGTGACGAGTGACAAGCACGGAATGCCGAGCGAGAGAGGCGGTCAG
AACCAACCCGCCAAGTCCCCGACGAAAGAAAAGCCAAGGCCCGAGGAGGAAGGACGATGTGAGCACACGGACAGC
AGCAGCGAGTCACCGATTGCCGGTGGCCAGCCTGGTGTCGATCAGGCGGACCCGATGGACGTTGATGAAGCCCCG
GTCGACGAGACAGCAACCGCGTCACGGGCCGGCCAAGATACGCAACTCGAAAATGAACTGCAGGCATCCCTCATA
CAGGAAGACGAGCCTGTGGATGAGCCCATGGAAGACGAGTCAGGGAGCAACGAGGCGGATCCTGCCGTTTCCGAA
TCCCAGCCTACGGAAATGGAAGTCGAGCGTGGAGTGCCTTCTCAGGCCTCGGACGCCTTGATGCGGGATGTTGAC
GAGGACGAGTCGTCCGAGGCTCGTCGAGCTGAACGGCAGACTACGGTTGCAGATGTGGCCGGGGCGGTCTCCGAG
GGCCAGCAGCAGGCCGGCGCGGCGTCGATGACGGAAACTCAGCGAGGTACCTCGGGGCCCACAGCCACGGAGCCC
GCAGCCGCGGCGGAAGCTTCGGAACCGAGGGACTCGGATGAAGGCACTCAGCAGCCGATGACGCCGGCTCAGTCC
CAACACAAGGACAACACTTGTCGCGCGGTGCCCCGGTCAGAGGGCGCCCCGGACGAGGACGAAGATGAGGCGGCA
GAGGCCCAGATCATTTCAGAGTACCACGAACGTCAGGCGCCTACAAAGCCGTCGGCGAGTACGGCAGATAAGGCG
AGTGCCGGATCGAAAGTGGCATCGCCCGACTCAAGCGAGGTCATAGACGATGATCGGCCCAAGGGCGGCCAGGAA
CTGGAGGTCCAGATCACGGTCAAGCCGCGTAAGGGCCGGCACCGGAGGACCAGGTCTGGCGGCAATAGCGGACGC
GGCGGGGCGCACGCGGACCCCAGCCTCGTCCTGGCCAAGGCGCCGACCTCCGAGGGTTCGGTGCCCGAGTCGGAG
AAGGAGCTCAAACCACCGACGAGGCTGCGAGTGGCCGGCACGAAGAGCGACGAGACGGATCCGAGCCTGCGCCTG
GCAACGGATGTAACTCATGCGAAAGACGATGGCTCGCCGCGGACGCCACGTGCCGGACGCAGCGCGGCGGTGGAA
GCGGAGCGGACGACGCCGTCGGCCGTGGCGTCGACTCCGACGTCGGCGAGCAGACGGCAACGAGCCACGCCGGAA
GTGACTCGGGAACTACGCAGCAGGGCGCACGCCAGTCCGGATGTCGGGGCCGAGGCGGCGTTGGAGTCGCCGTCG
GTGGCCGGCTCGATGGCGGAAGACCAGGACGCGGCGGCGCTGAAACGGAATCTGCAGAAGTCGCTGCGGACGTCG
CTGGCCGACTTCTTGCCGCTCAAGTCGCTGCGGGAGTCGCTCAACAAGACGACGGACATAGTGGCGGTGGCGACG
CTGACGCCGCCGCAGCCGCACCGGCCCAAGCACGGCCCACGCGACTACATGATGGAGCTGATCCTCACGGACCCG
TCGACGGCGCCGACGAGCGTCATCGTGGCTCACCTGTTCCGGCAGCACCAGGCGTCGCTGCCGGTGGTGCAGGCG
GGAGACGTCGTGCTCCTGCGTCGGGTGCAGGTCGTCTCGGTGCAGGGCCGCGGGTTCGGCGTGCGGGTCAAGGAC
GAGTCGGCGTGGGCGGTGTTCGAGAAGGGGGACGAGGAGATGCTGCCGCAGATCAAGGGCCCGCCGGTGGAGGTG
ACGGCGGCCGAGGCCGAGCACGCGCAGGGGCTCAGGCGGTGGTGGGCGATGCAGGACGAAAGGGCCTTGGCCAAG
GTCGATAAGGCGGCCCACAAGGCATCGTCGCAGGCCGGCAAGAACGAGGCAAAGTGA
Gene >Hirsu2|1274
ATGGCCGACGGTCGGCTGGCAGTGGAGGCGCTCCGTAGCACCGACGCCACACCCATCGCGAAGCTCCATCCGGAC
ATCGAAAATTCCCAGTCGCGAGCCGTCGACGGCGTCGTCACCATCACCTGGCCCTACAGCGTCGTCAAGGAGTCG
ATTGCCTTCGTCCTTGCCGAGCGCGACTTCCGCCTGCGGCGCCAGAGCGGACAGCTTCGCGTCGAGTTCCGCGGC
CCTGCAGCCAAGGCACTCGTCGACCTGCGCGTCGGCGGCGGCGACGAGGTCCGCCTCAGTTTGGACGGCGCCACG
TGGGACGGCGACCAAGCCCCGACGCAGCTCCCCGCCGGCGCCCTGGAGTGGCAGCTTAGCTTTTCCAACCGCCTG
CTGTTGATCCTTCGTCGGGCAGACGGCCAGGGCTCCGACGCGATAGATATCCATGCCCCCAACGACGAGGACGCG
CAGGCACACGAGCAGCTGGAATCCTCGACCGACAAACGTACCCCTCCCCCACCCGATCCCCCGCAAGTTGTCGCC
TCGCCCAACGACGATGTTCCGCCCTCGCTGGCCGCGAAGAGGCAAGCCTCGTCGATGTTGGGGCCCGACGAATTC
GCGTCTCCCGCCTTCATCAAACGCGCCAGGGTGTCATACGGGTCTTTATTCGAGGGCGGCCTCGACATTTTTGAT
GAGGAAAGGGGGAGGGAGACCAGGGATAGGAAGAAGCGGCGCTCGCGCTTCAGCATGCCGGGCACGTCGTGGAAA
TACAGCAGCCGGTCGCCAAGCCCCGAGGCGAGCCGGTCGCCAAGCCACGGCAGCGTCGCCGCCGACGAAGCGAGA
AAGAGGCCCGAACAGGAGGCGGCTTCAGATGCTCCCAAGACCTCGCCGCATCGACCAGTGATGGTCGATGAAGCA
TGCCAAACGCACGACGAGTTTTTCAGTCCGTCGCATGTGGACGTTTACGTCTCGGCCGAAGCGCGCTTCTCGGGT
TCTGCGATGCGACCGACATCGGCCTCGGCTCCTCCCGAGGCTCACCATCAACTTGGCCACGACACGCTCCAGACG
CCTTCGAGAATGCTCTTCGATCGCGGTTCGGAGCAGCACGTCCTGACGAGGTCGGCCGTGGAGCCCAGCATGGGT
TACGAAACGACCTTCGCCTTTGGGACGGAGCAACATCACGAGCCGGCGCACTTGCTCAGCGCACCGTCCATGTCC
AACCCGGCGATGAGCTCGGCGAGCTTTAGCAGTCAGGCCATGTCAGCCCCGGACTATCATCTTGCGACCTTTGGA
GGTCATCCCTCCCCGTCCTCAGCGCTCAATATCGACCCAGGCCTGCAGTTCCCCAACGAAATGCATGCGCCGGAT
CACTTGTATTATGGTGGCCCCGTGCCGGAAGACGCCACATGGAACCCTGGACCTCTTCCGCCCGCCGAGCCGCCC
ATTTCGGTTCAGGACGGCATGCACCGCCCCGGGGTCTTGGCGGATGGATCTCTCGTGAGGGGTGCGGCGTCCGGT
GCTCACCCAGGACCAGAGGATTCGGAAAGATCGGTGCCTGCCAGGCCCCCCTCCCGCCAAAACGGCAGACCCGAG
TCGGGCGGCTCAGTCGAGAGAGCCGAAGAAGCGGCGTCGGCGGCGGCGGCGGCGGCGGATCAAGACGACGTCGAT
GGCGAGGATGATGACGCCGAGGACATCCCAGGTGAAGACTACGACTTGAGGAACTACGACCGCGCCAGAGATGAC
GACGACGAGGAAGATTCAGAGGAGGAGTCGGAGCCCGACAGTAGTGATGTGGAGCGGCGAGCGATCGACTTCTCC
GAGGAAGACAGTCAAGACGAGCAGGAAAGAGACGAGCCAGACCTTGAGCTAGATGGTGAGGCCAGACGGGACGAG
GGATCCAGTGACAGTCTCAACGACAGCCGTGACGACGATGACGACGACGGCGCCGAGTATGCCAGCTCGGACGGC
GAAGACGAGTTGAGCGCCGGCGCAGAACACTTTGACGGCTATAGAGGACATTATGAGGCGTCGCGAGATTATGAT
GAGGACGACGAAGACGGGTACTTTGAGCGGCGCGAATTCGGGGATGAAGGAGAAGAGTCCGAAGAAGACGACGAT
GGTTTCGGCCCCACATCAGTTGCTGCGGACCCTGTGGTTATCAGCCTCCTTTCGGACTCCGAGGCCGAGGACTCC
GAGCCGGCCGAGGAGGAATCTGCCCTCAGAAATCCCCCCCCGCGGCACGGAGAGGCGGGCCTCGAACGGCCGGAC
GAGGGAACTTCGGCCGACCGCGCACGAAGAGAGGCGCCGTCGGCCCAGGCCAGTCCAGGCGGTGGACACGATGCT
GCTGGGGATGGCGTTGGCGAACAATCGGCCCCCAAAGCCGACCGCACACCCTGCCAACCTACGCAAAGTGCTACT
TCCCCTGAGGCGCCAAGCGACGAGCCTGGAGTGACGAGTGACAAGCACGGAATGCCGAGCGAGAGAGGCGGTCAG
AACCAACCCGCCAAGTCCCCGACGAAAGAAAAGCCAAGGCCCGAGGAGGAAGGACGATGTGAGCACACGGACAGC
AGCAGCGAGTCACCGATTGCCGGTGGCCAGCCTGGTGTCGATCAGGCGGACCCGATGGACGTTGATGAAGCCCCG
GTCGACGAGACAGCAACCGCGTCACGGGCCGGCCAAGATACGCAACTCGAAAATGAACTGCAGGCATCCCTCATA
CAGGAAGACGAGCCTGTGGATGAGCCCATGGAAGACGAGTCAGGGAGCAACGAGGCGGATCCTGCCGTTTCCGAA
TCCCAGCCTACGGAAATGGAAGTCGAGCGTGGAGTGCCTTCTCAGGCCTCGGACGCCTTGATGCGGGATGTTGAC
GAGGACGAGTCGTCCGAGGCTCGTCGAGCTGAACGGCAGACTACGGTTGCAGATGTGGCCGGGGCGGTCTCCGAG
GGCCAGCAGCAGGCCGGCGCGGCGTCGATGACGGAAACTCAGCGAGGTACCTCGGGGCCCACAGCCACGGAGCCC
GCAGCCGCGGCGGAAGCTTCGGAACCGAGGGACTCGGATGAAGGCACTCAGCAGCCGATGACGCCGGCTCAGTCC
CAACACAAGGACAACACTTGTCGCGCGGTGCCCCGGTCAGAGGGCGCCCCGGACGAGGACGAAGATGAGGCGGCA
GAGGCCCAGATCATTTCAGAGTACCACGAACGTCAGGCGCCTACAAAGCCGTCGGCGAGTACGGCAGATAAGGCG
AGTGCCGGATCGAAAGTGGCATCGCCCGACTCAAGCGAGGTCATAGACGATGATCGGCCCAAGGGCGGCCAGGAA
CTGGAGGTCCAGATCACGGTCAAGCCGCGTAAGGGCCGGCACCGGAGGACCAGGTCTGGCGGCAATAGCGGACGC
GGCGGGGCGCACGCGGACCCCAGCCTCGTCCTGGCCAAGGCGCCGACCTCCGAGGGTTCGGTGCCCGAGTCGGAG
AAGGAGCTCAAACCACCGACGAGGCTGCGAGTGGCCGGCACGAAGAGCGACGAGACGGATCCGAGCCTGCGCCTG
GCAACGGATGTAACTCATGCGAAAGACGATGGCTCGCCGCGGACGCCACGTGCCGGACGCAGCGCGGCGGTGGAA
GCGGAGCGGACGACGCCGTCGGCCGTGGCGTCGACTCCGACGTCGGCGAGCAGACGGCAACGAGCCACGCCGGAA
GTGACTCGGGAACTACGCAGCAGGGCGCACGCCAGTCCGGATGTCGGGGCCGAGGCGGCGTTGGAGTCGCCGTCG
GTGGCCGGCTCGATGGCGGAAGACCAGGACGCGGCGGCGCTGAAACGGAATCTGCAGAAGTCGCTGCGGACGTCG
CTGGCCGACTTCTTGCCGCTCAAGTCGCTGCGGGAGTCGCTCAACAAGACGACGGACATAGTGGCGGTGGCGACG
CTGACGCCGCCGCAGCCGCACCGGCCCAAGCACGGCCCACGCGACTACATGATGGAGCTGATCCTCACGGACCCG
TCGACGGCGCCGACGAGCGTCATCGTGGCTCACCTGTTCCGGCAGCACCAGGCGTCGCTGCCGGTGGTGCAGGCG
GGAGACGTCGTGCTCCTGCGTCGGGTGCAGGTCGTCTCGGTGCAGGGCCGCGGGTTCGGCGTGCGGGTCAAGGAC
GAGTCGGCGTGGGCGGTGTTCGAGAAGGGGGACGAGGAGATGCTGCCGCAGATCAAGGGCCCGCCGGTGGAGGTG
ACGGCGGCCGAGGCCGAGCACGCGCAGGGGCTCAGGCGGTGGTGGGCGATGCAGGACGAAAGGGCCTTGGCCAAG
GTCGATAAGGCGGCCCACAAGGCATCGTCGCAGGCCGGCAAGAACGAGGCAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail