Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1272
Gene name
LocationContig_128:5802..8107
Strand-
Gene length (bp)2305
Transcript length (bp)1896
Coding sequence length (bp)1896
Protein length (aa) 632

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03949 Malic_M Malic enzyme, NAD binding domain 1.7E-92 320 586
PF00390 malic Malic enzyme, N-terminal domain 7.3E-72 131 310

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6TU48|MAOX_DICDI NADP-dependent malic enzyme OS=Dictyostelium discoideum GN=malA PE=2 SV=1 69 595 2.0E-166
sp|P48163|MAOX_HUMAN NADP-dependent malic enzyme OS=Homo sapiens GN=ME1 PE=1 SV=1 61 589 8.0E-150
sp|P40927|MAOX_COLLI NADP-dependent malic enzyme OS=Columba livia GN=ME1 PE=1 SV=1 66 624 5.0E-149
sp|Q8BMF3|MAON_MOUSE NADP-dependent malic enzyme, mitochondrial OS=Mus musculus GN=Me3 PE=1 SV=2 66 621 1.0E-147
sp|P34105|MAOX_POPTR NADP-dependent malic enzyme OS=Populus trichocarpa PE=2 SV=3 64 592 2.0E-147
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6TU48|MAOX_DICDI NADP-dependent malic enzyme OS=Dictyostelium discoideum GN=malA PE=2 SV=1 69 595 2.0E-166
sp|P48163|MAOX_HUMAN NADP-dependent malic enzyme OS=Homo sapiens GN=ME1 PE=1 SV=1 61 589 8.0E-150
sp|P40927|MAOX_COLLI NADP-dependent malic enzyme OS=Columba livia GN=ME1 PE=1 SV=1 66 624 5.0E-149
sp|Q8BMF3|MAON_MOUSE NADP-dependent malic enzyme, mitochondrial OS=Mus musculus GN=Me3 PE=1 SV=2 66 621 1.0E-147
sp|P34105|MAOX_POPTR NADP-dependent malic enzyme OS=Populus trichocarpa PE=2 SV=3 64 592 2.0E-147
sp|O82191|MAOP1_ARATH NADP-dependent malic enzyme 1 OS=Arabidopsis thaliana GN=NADP-ME1 PE=1 SV=1 64 592 7.0E-147
sp|Q16798|MAON_HUMAN NADP-dependent malic enzyme, mitochondrial OS=Homo sapiens GN=ME3 PE=2 SV=2 66 621 1.0E-146
sp|P13697|MAOX_RAT NADP-dependent malic enzyme OS=Rattus norvegicus GN=Me1 PE=1 SV=2 61 603 2.0E-146
sp|P28227|MAOX_ANAPL NADP-dependent malic enzyme OS=Anas platyrhynchos GN=ME1 PE=1 SV=1 66 619 3.0E-146
sp|P06801|MAOX_MOUSE NADP-dependent malic enzyme OS=Mus musculus GN=Me1 PE=1 SV=2 61 603 3.0E-146
sp|P16243|MAOC_MAIZE NADP-dependent malic enzyme, chloroplastic OS=Zea mays GN=MOD1 PE=1 SV=1 64 592 8.0E-146
sp|P36444|MAOC_FLAPR NADP-dependent malic enzyme, chloroplastic OS=Flaveria pringlei GN=MODA PE=2 SV=1 13 621 9.0E-146
sp|P51615|MAOX_VITVI NADP-dependent malic enzyme OS=Vitis vinifera PE=2 SV=1 64 596 8.0E-145
sp|Q9XGZ0|MAOP3_ARATH NADP-dependent malic enzyme 3 OS=Arabidopsis thaliana GN=NADP-ME3 PE=1 SV=1 64 595 1.0E-144
sp|P22178|MAOC_FLATR NADP-dependent malic enzyme, chloroplastic OS=Flaveria trinervia GN=MOD1 PE=2 SV=1 64 621 2.0E-144
sp|Q29558|MAOX_PIG NADP-dependent malic enzyme (Fragment) OS=Sus scrofa GN=ME1 PE=2 SV=1 66 596 8.0E-144
sp|P37223|MAOX_MESCR NADP-dependent malic enzyme OS=Mesembryanthemum crystallinum GN=MOD1 PE=2 SV=1 64 596 8.0E-144
sp|Q9CA83|MAOP4_ARATH NADP-dependent malic enzyme 4, chloroplastic OS=Arabidopsis thaliana GN=NADP-ME4 PE=1 SV=1 64 596 1.0E-142
sp|P43279|MAOC_ORYSJ NADP-dependent malic enzyme, chloroplastic OS=Oryza sativa subsp. japonica GN=ME6 PE=2 SV=2 64 596 6.0E-142
sp|P12628|MAOX_PHAVU NADP-dependent malic enzyme OS=Phaseolus vulgaris GN=ME1 PE=2 SV=1 64 598 3.0E-140
sp|Q9LYG3|MAOP2_ARATH NADP-dependent malic enzyme 2 OS=Arabidopsis thaliana GN=NADP-ME2 PE=1 SV=1 64 595 5.0E-140
sp|Q99KE1|MAOM_MOUSE NAD-dependent malic enzyme, mitochondrial OS=Mus musculus GN=Me2 PE=1 SV=1 61 579 5.0E-140
sp|Q8L7K9|MAO2_ARATH NAD-dependent malic enzyme 2, mitochondrial OS=Arabidopsis thaliana GN=NAD-ME2 PE=1 SV=1 66 593 3.0E-139
sp|P37222|MAOC_SOLLC NADP-dependent malic enzyme, chloroplastic (Fragment) OS=Solanum lycopersicum PE=2 SV=1 64 621 9.0E-139
sp|Q9SIU0|MAO1_ARATH NAD-dependent malic enzyme 1, mitochondrial OS=Arabidopsis thaliana GN=NAD-ME1 PE=1 SV=1 47 621 2.0E-136
sp|P37225|MAON_SOLTU NAD-dependent malic enzyme 59 kDa isoform, mitochondrial OS=Solanum tuberosum PE=1 SV=1 66 586 7.0E-136
sp|P23368|MAOM_HUMAN NAD-dependent malic enzyme, mitochondrial OS=Homo sapiens GN=ME2 PE=1 SV=1 61 582 2.0E-135
sp|P37221|MAOM_SOLTU NAD-dependent malic enzyme 62 kDa isoform, mitochondrial OS=Solanum tuberosum PE=1 SV=1 47 621 2.0E-134
sp|A7MN74|MAO1_CROS8 NAD-dependent malic enzyme OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=maeA PE=3 SV=2 65 592 5.0E-134
sp|P37224|MAOM_AMAHP NAD-dependent malic enzyme 65 kDa isoform, mitochondrial OS=Amaranthus hypochondriacus PE=1 SV=1 44 621 7.0E-134
sp|A1S8W7|MAO1_SHEAM NAD-dependent malic enzyme OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=maeA PE=3 SV=1 65 590 1.0E-133
sp|A8AGN6|MAO1_CITK8 NAD-dependent malic enzyme OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=maeA PE=3 SV=1 49 592 2.0E-133
sp|P27443|MAOM_ASCSU NAD-dependent malic enzyme, mitochondrial (Fragment) OS=Ascaris suum PE=1 SV=1 68 598 2.0E-133
sp|A9MR05|MAO1_SALAR NAD-dependent malic enzyme OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=maeA PE=3 SV=1 65 592 2.0E-132
sp|Q12RA0|MAO1_SHEDO NAD-dependent malic enzyme OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=maeA PE=3 SV=1 65 621 6.0E-132
sp|Q9KSR8|MAO1_VIBCH NAD-dependent malic enzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=maeA PE=3 SV=2 65 622 7.0E-132
sp|A5F1Z0|MAO1_VIBC3 NAD-dependent malic enzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=maeA PE=3 SV=2 65 622 7.0E-132
sp|Q6LQM6|MAO11_PHOPR NAD-dependent malic enzyme 1 OS=Photobacterium profundum GN=maeA1 PE=3 SV=2 65 590 1.0E-131
sp|B5F5W5|MAO1_SALA4 NAD-dependent malic enzyme OS=Salmonella agona (strain SL483) GN=maeA PE=3 SV=1 65 592 1.0E-131
sp|B5RAB4|MAO1_SALG2 NAD-dependent malic enzyme OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=maeA PE=3 SV=1 65 592 2.0E-131
sp|Q8ZPE8|MAO1_SALTY NAD-dependent malic enzyme OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=maeA PE=3 SV=1 65 592 2.0E-131
sp|Q8Z728|MAO1_SALTI NAD-dependent malic enzyme OS=Salmonella typhi GN=maeA PE=3 SV=2 65 592 2.0E-131
sp|B4TW15|MAO1_SALSV NAD-dependent malic enzyme OS=Salmonella schwarzengrund (strain CVM19633) GN=maeA PE=3 SV=1 65 592 2.0E-131
sp|A9MYU8|MAO1_SALPB NAD-dependent malic enzyme OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=maeA PE=3 SV=1 65 592 2.0E-131
sp|Q5PHY7|MAO1_SALPA NAD-dependent malic enzyme OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=maeA PE=3 SV=2 65 592 2.0E-131
sp|B4TII8|MAO1_SALHS NAD-dependent malic enzyme OS=Salmonella heidelberg (strain SL476) GN=maeA PE=3 SV=1 65 592 2.0E-131
sp|A6T9K7|MAO1_KLEP7 NAD-dependent malic enzyme OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=maeA PE=3 SV=1 65 592 2.0E-131
sp|B4T5V6|MAO1_SALNS NAD-dependent malic enzyme OS=Salmonella newport (strain SL254) GN=maeA PE=3 SV=1 65 592 2.0E-131
sp|Q57P88|MAO1_SALCH NAD-dependent malic enzyme OS=Salmonella choleraesuis (strain SC-B67) GN=maeA PE=3 SV=2 65 592 2.0E-131
sp|B5QTN6|MAO1_SALEP NAD-dependent malic enzyme OS=Salmonella enteritidis PT4 (strain P125109) GN=maeA PE=3 SV=1 65 592 2.0E-131
sp|B5FHJ6|MAO1_SALDC NAD-dependent malic enzyme OS=Salmonella dublin (strain CT_02021853) GN=maeA PE=3 SV=1 65 592 2.0E-131
sp|B2VIF2|MAO1_ERWT9 NAD-dependent malic enzyme OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=maeA PE=3 SV=1 65 592 3.0E-131
sp|A4WAJ3|MAO1_ENT38 NAD-dependent malic enzyme OS=Enterobacter sp. (strain 638) GN=maeA PE=3 SV=1 49 592 3.0E-131
sp|A1JTY5|MAO1_YERE8 NAD-dependent malic enzyme OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=maeA PE=3 SV=1 65 592 3.0E-131
sp|Q6FFL8|MAO1_ACIAD NAD-dependent malic enzyme OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=maeA PE=3 SV=1 48 592 5.0E-131
sp|B7L7H9|MAO1_ECO55 NAD-dependent malic enzyme OS=Escherichia coli (strain 55989 / EAEC) GN=maeA PE=3 SV=1 65 592 8.0E-131
sp|A7ZLS1|MAO1_ECO24 NAD-dependent malic enzyme OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=maeA PE=3 SV=1 65 592 8.0E-131
sp|B5Z1T9|MAO1_ECO5E NAD-dependent malic enzyme OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=maeA PE=3 SV=1 65 592 9.0E-131
sp|Q8XAS9|MAO1_ECO57 NAD-dependent malic enzyme OS=Escherichia coli O157:H7 GN=maeA PE=3 SV=2 65 592 9.0E-131
sp|B1JPZ6|MAO1_YERPY NAD-dependent malic enzyme OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|Q66C80|MAO1_YERPS NAD-dependent malic enzyme OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|A4TKN8|MAO1_YERPP NAD-dependent malic enzyme OS=Yersinia pestis (strain Pestoides F) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|Q1CGT4|MAO1_YERPN NAD-dependent malic enzyme OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|Q8ZG09|MAO1_YERPE NAD-dependent malic enzyme OS=Yersinia pestis GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|B2JZJ5|MAO1_YERPB NAD-dependent malic enzyme OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|Q1C9U8|MAO1_YERPA NAD-dependent malic enzyme OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|A7FJK4|MAO1_YERP3 NAD-dependent malic enzyme OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|Q1RBT9|MAO1_ECOUT NAD-dependent malic enzyme OS=Escherichia coli (strain UTI89 / UPEC) GN=maeA PE=3 SV=2 65 592 1.0E-130
sp|Q0THU1|MAO1_ECOL5 NAD-dependent malic enzyme OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|A1AB75|MAO1_ECOK1 NAD-dependent malic enzyme OS=Escherichia coli O1:K1 / APEC GN=maeA PE=3 SV=2 65 592 1.0E-130
sp|B7NHU3|MAO1_ECO7I NAD-dependent malic enzyme OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|B7MMW1|MAO1_ECO45 NAD-dependent malic enzyme OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|B7URL9|MAO1_ECO27 NAD-dependent malic enzyme OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|B1LFD8|MAO1_ECOSM NAD-dependent malic enzyme OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|Q83ML6|MAO1_SHIFL NAD-dependent malic enzyme OS=Shigella flexneri GN=maeA PE=3 SV=4 65 592 1.0E-130
sp|Q0T457|MAO1_SHIF8 NAD-dependent malic enzyme OS=Shigella flexneri serotype 5b (strain 8401) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|B7LQX1|MAO1_ESCF3 NAD-dependent malic enzyme OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|B7N4P2|MAO1_ECOLU NAD-dependent malic enzyme OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|B7LZ73|MAO1_ECO8A NAD-dependent malic enzyme OS=Escherichia coli O8 (strain IAI1) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|B7MUR3|MAO1_ECO81 NAD-dependent malic enzyme OS=Escherichia coli O81 (strain ED1a) GN=maeA PE=3 SV=1 65 592 1.0E-130
sp|Q3Z1M2|MAO1_SHISS NAD-dependent malic enzyme OS=Shigella sonnei (strain Ss046) GN=maeA PE=3 SV=2 65 592 1.0E-130
sp|Q8FHH1|MAO1_ECOL6 NAD-dependent malic enzyme OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=maeA PE=3 SV=2 65 592 1.0E-130
sp|A0KHR8|MAO1_AERHH NAD-dependent malic enzyme OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=maeA PE=3 SV=2 65 590 2.0E-130
sp|P26616|MAO1_ECOLI NAD-dependent malic enzyme OS=Escherichia coli (strain K12) GN=maeA PE=1 SV=4 65 592 2.0E-130
sp|B1XE70|MAO1_ECODH NAD-dependent malic enzyme OS=Escherichia coli (strain K12 / DH10B) GN=maeA PE=3 SV=1 65 592 2.0E-130
sp|C4ZWP8|MAO1_ECOBW NAD-dependent malic enzyme OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=maeA PE=3 SV=1 65 592 2.0E-130
sp|B5XX25|MAO1_KLEP3 NAD-dependent malic enzyme OS=Klebsiella pneumoniae (strain 342) GN=maeA PE=3 SV=1 65 592 2.0E-130
sp|B1IRX9|MAO1_ECOLC NAD-dependent malic enzyme OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=maeA PE=3 SV=1 65 592 2.0E-130
sp|A8A036|MAO1_ECOHS NAD-dependent malic enzyme OS=Escherichia coli O9:H4 (strain HS) GN=maeA PE=3 SV=1 65 592 2.0E-130
sp|A4SKE9|MAO1_AERS4 NAD-dependent malic enzyme OS=Aeromonas salmonicida (strain A449) GN=maeA PE=3 SV=1 65 590 3.0E-130
sp|Q320R8|MAO1_SHIBS NAD-dependent malic enzyme OS=Shigella boydii serotype 4 (strain Sb227) GN=maeA PE=3 SV=2 65 592 5.0E-130
sp|B2U1M1|MAO1_SHIB3 NAD-dependent malic enzyme OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=maeA PE=3 SV=1 65 592 5.0E-130
sp|B4ESY2|MAO1_PROMH NAD-dependent malic enzyme OS=Proteus mirabilis (strain HI4320) GN=maeA PE=3 SV=1 65 621 8.0E-130
sp|Q8D911|MAO1_VIBVU NAD-dependent malic enzyme OS=Vibrio vulnificus (strain CMCP6) GN=maeA PE=3 SV=1 65 622 9.0E-130
sp|Q7MLG3|MAO11_VIBVY NAD-dependent malic enzyme 1 OS=Vibrio vulnificus (strain YJ016) GN=maeA1 PE=3 SV=2 65 622 9.0E-130
sp|B6EK11|MAO1_ALISL NAD-dependent malic enzyme OS=Aliivibrio salmonicida (strain LFI1238) GN=maeA PE=3 SV=1 65 622 1.0E-129
sp|O34389|MAO3_BACSU Probable NAD-dependent malic enzyme 3 OS=Bacillus subtilis (strain 168) GN=malS PE=3 SV=1 66 598 3.0E-129
sp|Q5E4J3|MAO1_VIBF1 NAD-dependent malic enzyme OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=maeA PE=3 SV=1 65 622 3.0E-129
sp|B5FEY5|MAO1_VIBFM NAD-dependent malic enzyme OS=Vibrio fischeri (strain MJ11) GN=maeA PE=3 SV=1 65 590 9.0E-129
sp|Q2NUD3|MAO1_SODGM NAD-dependent malic enzyme OS=Sodalis glossinidius (strain morsitans) GN=maeA PE=3 SV=1 58 592 2.0E-128
sp|Q7N6K4|MAO1_PHOLL NAD-dependent malic enzyme OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=maeA PE=3 SV=1 65 597 2.0E-128
sp|A8H7G5|MAO1_SHEPA NAD-dependent malic enzyme OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=maeA PE=3 SV=1 65 590 7.0E-128
sp|A8GC31|MAO1_SERP5 NAD-dependent malic enzyme OS=Serratia proteamaculans (strain 568) GN=maeA PE=3 SV=1 65 592 1.0E-127
sp|C5BCM3|MAO1_EDWI9 NAD-dependent malic enzyme OS=Edwardsiella ictaluri (strain 93-146) GN=maeA PE=3 SV=1 65 592 2.0E-127
sp|C6DDS6|MAO1_PECCP NAD-dependent malic enzyme OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=maeA PE=3 SV=1 61 592 3.0E-127
sp|A7N025|MAO1_VIBCB NAD-dependent malic enzyme OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=maeA PE=3 SV=1 65 592 3.0E-127
sp|B8CQT6|MAO1_SHEPW NAD-dependent malic enzyme OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=maeA PE=3 SV=1 65 590 5.0E-127
sp|A8FZ49|MAO1_SHESH NAD-dependent malic enzyme OS=Shewanella sediminis (strain HAW-EB3) GN=maeA PE=3 SV=1 65 590 6.0E-127
sp|Q87Q92|MAO1_VIBPA NAD-dependent malic enzyme OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=maeA PE=3 SV=1 65 592 7.0E-127
sp|Q6D3B3|MAO1_PECAS NAD-dependent malic enzyme OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=maeA PE=3 SV=1 65 592 1.0E-126
sp|Q0HYM7|MAO1_SHESR NAD-dependent malic enzyme OS=Shewanella sp. (strain MR-7) GN=maeA PE=3 SV=1 65 592 2.0E-126
sp|Q0HFA9|MAO1_SHESM NAD-dependent malic enzyme OS=Shewanella sp. (strain MR-4) GN=maeA PE=3 SV=1 65 592 2.0E-126
sp|Q47WB0|MAO1_COLP3 NAD-dependent malic enzyme OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=maeA PE=3 SV=1 65 621 3.0E-126
sp|B0TRQ2|MAO1_SHEHH NAD-dependent malic enzyme OS=Shewanella halifaxensis (strain HAW-EB4) GN=maeA PE=3 SV=1 65 590 4.0E-126
sp|Q4FRX3|MAO1_PSYA2 NAD-dependent malic enzyme OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=maeA PE=3 SV=1 65 592 4.0E-126
sp|A1SSC6|MAO1_PSYIN NAD-dependent malic enzyme OS=Psychromonas ingrahamii (strain 37) GN=maeA PE=3 SV=1 65 592 4.0E-126
sp|Q1QC40|MAO1_PSYCK NAD-dependent malic enzyme OS=Psychrobacter cryohalolentis (strain K5) GN=maeA PE=3 SV=1 65 592 7.0E-126
sp|A0KT69|MAO1_SHESA NAD-dependent malic enzyme OS=Shewanella sp. (strain ANA-3) GN=maeA PE=3 SV=1 65 592 1.0E-125
sp|Q8EAP2|MAO1_SHEON NAD-dependent malic enzyme OS=Shewanella oneidensis (strain MR-1) GN=maeA PE=3 SV=1 65 592 1.0E-125
sp|A9L2F4|MAO1_SHEB9 NAD-dependent malic enzyme OS=Shewanella baltica (strain OS195) GN=maeA PE=3 SV=1 65 592 2.0E-125
sp|A3D0E1|MAO1_SHEB5 NAD-dependent malic enzyme OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=maeA PE=3 SV=1 65 592 2.0E-125
sp|Q87Y79|MAO1_PSESM NAD-dependent malic enzyme OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=maeA PE=3 SV=2 65 621 3.0E-125
sp|A3QH80|MAO1_SHELP NAD-dependent malic enzyme OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=maeA PE=3 SV=1 65 590 8.0E-125
sp|A6WSH0|MAO1_SHEB8 NAD-dependent malic enzyme OS=Shewanella baltica (strain OS185) GN=maeA PE=3 SV=1 65 592 8.0E-125
sp|B8E835|MAO1_SHEB2 NAD-dependent malic enzyme OS=Shewanella baltica (strain OS223) GN=maeA PE=3 SV=1 65 592 8.0E-125
sp|A1RNF8|MAO1_SHESW NAD-dependent malic enzyme OS=Shewanella sp. (strain W3-18-1) GN=maeA PE=3 SV=1 65 592 1.0E-124
sp|A4Y3I1|MAO1_SHEPC NAD-dependent malic enzyme OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=maeA PE=3 SV=1 65 592 1.0E-124
sp|Q48LC8|MAO1_PSE14 NAD-dependent malic enzyme OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=maeA PE=3 SV=2 65 592 2.0E-124
sp|Q4ZW63|MAO1_PSEU2 NAD-dependent malic enzyme OS=Pseudomonas syringae pv. syringae (strain B728a) GN=maeA PE=3 SV=2 65 592 2.0E-124
sp|B1KFN0|MAO1_SHEWM NAD-dependent malic enzyme OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=maeA PE=3 SV=1 65 590 5.0E-124
sp|Q5QWY8|MAO1_IDILO NAD-dependent malic enzyme OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=maeA PE=3 SV=1 65 592 6.0E-124
sp|Q086X9|MAO1_SHEFN NAD-dependent malic enzyme OS=Shewanella frigidimarina (strain NCIMB 400) GN=maeA PE=3 SV=1 65 592 8.0E-124
sp|P45868|MAO2_BACSU Probable NAD-dependent malic enzyme 2 OS=Bacillus subtilis (strain 168) GN=maeA PE=1 SV=1 66 598 2.0E-123
sp|Q6LHK5|MAO12_PHOPR NAD-dependent malic enzyme 2 OS=Photobacterium profundum GN=maeA2 PE=3 SV=1 52 586 4.0E-123
sp|Q9HYD5|MAO1_PSEAE NAD-dependent malic enzyme OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=maeA PE=3 SV=1 58 539 5.0E-122
sp|Q02QW0|MAO1_PSEAB NAD-dependent malic enzyme OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=maeA PE=3 SV=1 58 539 6.0E-122
sp|B7UWK9|MAO1_PSEA8 NAD-dependent malic enzyme OS=Pseudomonas aeruginosa (strain LESB58) GN=maeA PE=3 SV=1 58 539 2.0E-121
sp|Q7MJC0|MAO12_VIBVY NAD-dependent malic enzyme 2 OS=Vibrio vulnificus (strain YJ016) GN=maeA2 PE=3 SV=1 65 590 2.0E-118
sp|Q6MJE4|MAO1_BDEBA NAD-dependent malic enzyme OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=maeA PE=3 SV=1 65 592 5.0E-118
sp|A6V1V5|MAO1_PSEA7 NAD-dependent malic enzyme OS=Pseudomonas aeruginosa (strain PA7) GN=maeA PE=3 SV=1 58 540 2.0E-116
sp|Q48796|MLES_OENOE Malolactic enzyme OS=Oenococcus oeni GN=mleA PE=3 SV=1 69 597 7.0E-114
sp|P36013|MAOM_YEAST NAD-dependent malic enzyme, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAE1 PE=1 SV=1 67 597 2.0E-109
sp|P40375|MAOX_SCHPO NAD-dependent malic enzyme OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mae2 PE=1 SV=1 66 605 2.0E-108
sp|P78715|MAOH_NEOFR Malic enzyme, hydrogenosomal OS=Neocallimastix frontalis PE=1 SV=1 63 605 2.0E-107
sp|P9WK25|MAOX_MYCTU Putative malate oxidoreductase [NAD] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mez PE=1 SV=1 70 597 2.0E-102
sp|P9WK24|MAOX_MYCTO Putative malate oxidoreductase [NAD] OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mez PE=3 SV=1 70 597 2.0E-102
sp|Q48662|MLES_LACLA Malolactic enzyme OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=mleS PE=3 SV=2 66 596 4.0E-101
sp|P16468|MAOX_GEOSE NAD-dependent malic enzyme OS=Geobacillus stearothermophilus PE=1 SV=1 105 592 1.0E-20
sp|O34962|MAO4_BACSU Probable NAD-dependent malic enzyme 4 OS=Bacillus subtilis (strain 168) GN=ytsJ PE=3 SV=1 121 566 2.0E-18
sp|P54572|MAO1_BACSU Probable NAD-dependent malic enzyme 1 OS=Bacillus subtilis (strain 168) GN=yqkJ PE=3 SV=1 145 543 2.0E-15
sp|P43837|MAO2_HAEIN NADP-dependent malic enzyme OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=maeB PE=3 SV=1 146 628 5.0E-15
sp|O30808|MAO2_RHIME NADP-dependent malic enzyme OS=Rhizobium meliloti (strain 1021) GN=tme PE=1 SV=2 198 542 5.0E-11
sp|O30807|MAO1_RHIME NAD-dependent malic enzyme OS=Rhizobium meliloti (strain 1021) GN=dme PE=1 SV=1 142 552 5.0E-10
sp|Q9ZDF6|MAO2_RICPR Probable NADP-dependent malic enzyme OS=Rickettsia prowazekii (strain Madrid E) GN=RP373 PE=3 SV=1 149 542 5.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0004471 malate dehydrogenase (decarboxylating) (NAD+) activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0051287 NAD binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0016615 malate dehydrogenase activity No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0004470 malic enzyme activity No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1272
MATKRMSISGRRLTDFNPLSSVDVFALEEAMKTAALDQHRGYAQDRFAEVKQHRATDYLAHHQAAGYQVLREPLW
NKGLSFTPEERVSKNLTGLLPHAMESLQTQCARAMKMIQTRQTNIDKYLYLSSIKGQNTDLFYRLLMDNIRDLMP
LVYTPTIGDVCLQYSTIYTRPEALYISFKQRKSIRTMLRNWPCPNPEICVVTDGSRILGLGDLGVNGVGISIGKL
ALYTAAAGIHPDKTLPIVLDCGTDNETNLKDPFYLGLRQKRVSKQAQQEFMDEFMEAVQDVFPDMVVQFEDFESE
KAFKYLDQYRNTHKCFNDDIQGTGAVVLAGYIGAVNLSGVPIEEQRLVFMGAGSAGVGVAKQLVEYYTRRGLSEM
EARDKFWLVDTKGLVTKDRGDSLAEHKKYFARTDNHGQQFRSLEEVIEYVKPSALVGLTATFGVFTESVVRALKA
SVDGGGLGRRPILFPLSNPLTKAECTFEQAVQWTDGTAIFASGSPFQSFTVKVGGDAGAVTYHPNQGNNVYVFPG
LGLGAILAKATRVTNDMVYTSAEALAGTLNADEIHKGLIYPRIERVRDASVVVAREVMKAARRDGVSDLPEDMWN
EWEEWGDVALTAYIKKHIYDPMCFADAKGRL*
Coding >Hirsu2|1272
ATGGCGACTAAGCGCATGTCCATCTCGGGCCGCCGCCTCACCGACTTCAACCCCCTCTCCTCCGTCGACGTCTTC
GCCCTCGAGGAAGCCATGAAGACGGCCGCCCTGGACCAGCACCGCGGCTACGCACAGGACCGCTTTGCCGAGGTC
AAGCAGCACCGCGCCACCGACTACCTCGCCCACCACCAGGCCGCCGGCTACCAGGTCCTGCGCGAGCCGCTCTGG
AACAAAGGTCTCTCCTTCACGCCCGAGGAACGCGTCTCCAAGAACCTCACCGGCCTGCTCCCCCACGCCATGGAG
AGCCTGCAGACCCAGTGCGCCCGGGCCATGAAGATGATCCAGACGAGGCAGACCAACATCGACAAGTACCTCTAC
CTCTCCTCCATCAAGGGCCAGAACACGGACCTGTTCTACCGCCTCCTCATGGACAACATCCGCGACCTCATGCCC
CTCGTCTACACGCCCACTATCGGCGACGTCTGCCTGCAGTACTCGACCATCTACACCCGCCCCGAGGCCCTGTAC
ATCTCCTTCAAGCAGCGCAAGTCGATTCGCACCATGCTCCGCAACTGGCCCTGCCCGAACCCCGAGATTTGCGTC
GTCACCGACGGCTCCCGCATCCTCGGCCTCGGCGACCTCGGCGTCAACGGCGTCGGCATCTCGATTGGCAAGCTG
GCCCTGTACACGGCCGCGGCCGGCATCCACCCGGACAAGACGCTGCCCATCGTCTTGGACTGCGGCACCGACAAC
GAGACGAACCTCAAGGACCCCTTCTACCTGGGCCTGAGGCAGAAGCGCGTCTCCAAGCAGGCCCAGCAAGAGTTC
ATGGACGAGTTCATGGAGGCTGTCCAGGACGTCTTCCCCGACATGGTCGTCCAGTTTGAGGATTTCGAGAGCGAG
AAGGCCTTCAAGTACCTGGACCAGTACAGAAACACGCACAAATGCTTCAACGACGACATTCAGGGCACCGGCGCC
GTCGTCCTGGCTGGATACATTGGGGCTGTGAACCTGTCGGGCGTGCCCATCGAGGAGCAGCGCCTGGTCTTCATG
GGCGCCGGCTCGGCCGGCGTCGGCGTCGCCAAGCAGCTCGTCGAGTACTACACGCGCAGGGGCCTGTCGGAGATG
GAGGCCCGCGACAAGTTTTGGCTCGTCGACACCAAGGGCCTCGTGACCAAGGACCGGGGCGACAGCCTGGCCGAG
CACAAGAAGTACTTCGCCCGCACCGACAACCACGGCCAGCAGTTCCGCAGCCTGGAGGAGGTGATCGAATACGTC
AAGCCCAGCGCGCTGGTCGGCCTGACGGCCACCTTTGGCGTCTTCACCGAGTCGGTCGTGCGCGCCCTCAAGGCG
TCGGTCGACGGCGGCGGCCTGGGCCGGCGGCCCATCCTGTTCCCGCTCAGCAACCCGCTGACCAAGGCCGAGTGC
ACGTTCGAGCAGGCGGTGCAGTGGACGGACGGCACGGCCATCTTCGCCTCGGGCTCGCCCTTCCAGTCCTTCACG
GTCAAGGTGGGCGGCGACGCGGGCGCCGTCACGTACCACCCCAACCAGGGCAACAACGTCTACGTCTTCCCCGGC
CTGGGCCTGGGCGCCATCCTGGCCAAGGCGACGCGCGTGACCAACGACATGGTGTACACGTCGGCCGAAGCCCTG
GCCGGGACGCTCAACGCCGACGAGATCCACAAGGGGCTCATCTACCCCCGCATCGAGCGCGTCCGCGACGCCAGC
GTCGTCGTGGCCCGCGAGGTGATGAAGGCGGCCCGCCGCGACGGCGTCTCGGACCTGCCCGAGGACATGTGGAAC
GAGTGGGAGGAGTGGGGCGACGTGGCGCTGACGGCGTACATCAAGAAGCACATCTACGATCCCATGTGTTTTGCG
GACGCCAAGGGCCGTCTGTGA
Transcript >Hirsu2|1272
ATGGCGACTAAGCGCATGTCCATCTCGGGCCGCCGCCTCACCGACTTCAACCCCCTCTCCTCCGTCGACGTCTTC
GCCCTCGAGGAAGCCATGAAGACGGCCGCCCTGGACCAGCACCGCGGCTACGCACAGGACCGCTTTGCCGAGGTC
AAGCAGCACCGCGCCACCGACTACCTCGCCCACCACCAGGCCGCCGGCTACCAGGTCCTGCGCGAGCCGCTCTGG
AACAAAGGTCTCTCCTTCACGCCCGAGGAACGCGTCTCCAAGAACCTCACCGGCCTGCTCCCCCACGCCATGGAG
AGCCTGCAGACCCAGTGCGCCCGGGCCATGAAGATGATCCAGACGAGGCAGACCAACATCGACAAGTACCTCTAC
CTCTCCTCCATCAAGGGCCAGAACACGGACCTGTTCTACCGCCTCCTCATGGACAACATCCGCGACCTCATGCCC
CTCGTCTACACGCCCACTATCGGCGACGTCTGCCTGCAGTACTCGACCATCTACACCCGCCCCGAGGCCCTGTAC
ATCTCCTTCAAGCAGCGCAAGTCGATTCGCACCATGCTCCGCAACTGGCCCTGCCCGAACCCCGAGATTTGCGTC
GTCACCGACGGCTCCCGCATCCTCGGCCTCGGCGACCTCGGCGTCAACGGCGTCGGCATCTCGATTGGCAAGCTG
GCCCTGTACACGGCCGCGGCCGGCATCCACCCGGACAAGACGCTGCCCATCGTCTTGGACTGCGGCACCGACAAC
GAGACGAACCTCAAGGACCCCTTCTACCTGGGCCTGAGGCAGAAGCGCGTCTCCAAGCAGGCCCAGCAAGAGTTC
ATGGACGAGTTCATGGAGGCTGTCCAGGACGTCTTCCCCGACATGGTCGTCCAGTTTGAGGATTTCGAGAGCGAG
AAGGCCTTCAAGTACCTGGACCAGTACAGAAACACGCACAAATGCTTCAACGACGACATTCAGGGCACCGGCGCC
GTCGTCCTGGCTGGATACATTGGGGCTGTGAACCTGTCGGGCGTGCCCATCGAGGAGCAGCGCCTGGTCTTCATG
GGCGCCGGCTCGGCCGGCGTCGGCGTCGCCAAGCAGCTCGTCGAGTACTACACGCGCAGGGGCCTGTCGGAGATG
GAGGCCCGCGACAAGTTTTGGCTCGTCGACACCAAGGGCCTCGTGACCAAGGACCGGGGCGACAGCCTGGCCGAG
CACAAGAAGTACTTCGCCCGCACCGACAACCACGGCCAGCAGTTCCGCAGCCTGGAGGAGGTGATCGAATACGTC
AAGCCCAGCGCGCTGGTCGGCCTGACGGCCACCTTTGGCGTCTTCACCGAGTCGGTCGTGCGCGCCCTCAAGGCG
TCGGTCGACGGCGGCGGCCTGGGCCGGCGGCCCATCCTGTTCCCGCTCAGCAACCCGCTGACCAAGGCCGAGTGC
ACGTTCGAGCAGGCGGTGCAGTGGACGGACGGCACGGCCATCTTCGCCTCGGGCTCGCCCTTCCAGTCCTTCACG
GTCAAGGTGGGCGGCGACGCGGGCGCCGTCACGTACCACCCCAACCAGGGCAACAACGTCTACGTCTTCCCCGGC
CTGGGCCTGGGCGCCATCCTGGCCAAGGCGACGCGCGTGACCAACGACATGGTGTACACGTCGGCCGAAGCCCTG
GCCGGGACGCTCAACGCCGACGAGATCCACAAGGGGCTCATCTACCCCCGCATCGAGCGCGTCCGCGACGCCAGC
GTCGTCGTGGCCCGCGAGGTGATGAAGGCGGCCCGCCGCGACGGCGTCTCGGACCTGCCCGAGGACATGTGGAAC
GAGTGGGAGGAGTGGGGCGACGTGGCGCTGACGGCGTACATCAAGAAGCACATCTACGATCCCATGTGTTTTGCG
GACGCCAAGGGCCGTCTGTGA
Gene >Hirsu2|1272
ATGGCGACGTACGTGTACGCTGCCGACGTCTCTGACGACTCCCTGTCGCGTTCTTCCGCCTCTAGGACCTCGTCC
GTAGCCTCGGGGCGCTCCTCCCACACCTCCCTCTCCAGTAAGCGCATGTCCATCTCGGGCCGCCGCCTCACCGAC
TTCAACCCCCTCTCCTCCGTCGACGTCTTCGCCCTCGAGGAAGCCATGAAGACGGCCGCCCTGGACCAGCACCGC
GGCTACGCACAGGACCGCTTTGCCGAGGTCAAGCAGCACCGCGCCACCGACTACCTCGCCCACCACCAGGCCGCC
GGCTACCAGGTCCTGCGCGAGCCGCTCTGGAACAAAGGTAATCGTCGTCGCCGGCCCGCCCGTCGTCTCCCCGCC
CCCTCCCCCCTCACACCACTCCGTCACCTCGTCCGCCCGCCTCCCAGCCTGCTCGCTAACACTCGCCCTCCCCTT
CCGGCCAGGTCTCTCCTTCACGCCCGAGGAACGCGTCTCCAAGAACCTCACCGGCCTGCTCCCCCACGCCATGGA
GAGCCTGCAGACCCAGTGCGCCCGGGCCATGAAGATGATCCAGACGAGGCAGACCAACATCGACAAGTACCTCTA
CCTCTCCTCCATCAAGGGCCAGAACACGGACCTGTTCTACCGCCTCCTCATGGACAACATCCGCGACCTCATGCC
CCTCGTCTACACGCCCACTATCGGCGACGTCTGCCTGCAGTACTCGACCATCTACACCCGCCCCGAGGCCCTGTA
CATCTCCTTCAAGCAGCGCAAGTCGATTCGCACCATGCTCCGCAACTGGCCCTGCCCGAACCCCGAGATTTGCGT
CGTCACCGACGGCTCCCGCATCCTCGGCCTCGGCGACCTCGGCGTCAACGGCGTCGGCATCTCGGTGAGTCTTGG
CTCCCCCCTCGCCCTCTGTATCACATTGGAGGGGCGCCGAACCCCGGCCCGCTGACTTCCGACGCCCGACGCCCC
AGATTGGCAAGCTGGCCCTGTACACGGCCGCGGCCGGCATCCACCCGGACAAGACGCTGCCCATCGTCTTGGACT
GCGGCACCGACAACGAGACGAACCTCAAGGACCCCTTCTACCTGGGCCTGAGGCAGAAGCGCGTCTCCAAGCAGG
CCCAGCAAGAGTTCATGGACGAGTTCATGGAGGCTGTCCAGGACGTCTTCCCCGACATGGTCGTCCAGTTTGAGG
ATTTCGAGAGCGAGAAGGCCTTCAAGTACCTGGACCAGTACAGAAACACGCACAAATGCTTCAACGACGACATTC
AGGGCACCGGCGCCGTCGTCCTGGCTGGGTGAGTTCGCCCCGACTCCGAGACTCCGGGGGGGTGCTCGGACCTTG
TCCGTCCCCGCCCGCGCGCCCTCTCACGCGCTGACGCCCGTCCACCAGATACATTGGGGCTGTGAACCTGTCGGG
CGTGCCCATCGAGGAGCAGCGCCTGGTCTTCATGGGCGCCGGCTCGGCCGGCGTCGGCGTCGCCAAGCAGCTCGT
CGAGTACTACACGCGCAGGGGCCTGTCGGAGATGGAGGCCCGCGACAAGTTTTGGCTCGTCGACACCAAGGGCCT
CGTGACCAAGGACCGGGGCGACAGCCTGGCCGAGCACAAGAAGTACTTCGCCCGCACCGACAACCACGGCCAGCA
GTTCCGCAGCCTGGAGGAGGTGATCGAATACGTCAAGCCCAGCGCGCTGGTCGGCCTGACGGCCACCTTTGGCGT
CTTCACCGAGTCGGTCGTGCGCGCCCTCAAGGCGTCGGTCGACGGCGGCGGCCTGGGCCGGCGGCCCATCCTGTT
CCCGCTCAGCAACCCGCTGACCAAGGCCGAGTGCACGTTCGAGCAGGCGGTGCAGTGGACGGACGGCACGGCCAT
CTTCGCCTCGGGCTCGCCCTTCCAGTCCTTCACGGTCAAGGTGGGCGGCGACGCGGGCGCCGTCACGTACCACCC
CAACCAGGGCAACAACGTCTACGTCTTCCCCGGCCTGGGCCTGGGCGCCATCCTGGCCAAGGCGACGCGCGTGAC
CAACGACATGGTGTACACGTCGGCCGAAGCCCTGGCCGGGACGCTCAACGCCGACGAGATCCACAAGGGGCTCAT
CTACCCCCGCATCGAGCGCGTCCGCGACGCCAGCGTCGTCGTGGCCCGCGAGGTGATGAAGGCGGCCCGCCGCGA
CGGCGTCTCGGACCTGCCCGAGGACATGTGGAACGAGTGGGAGGAGTGGGGCGACGTGGCGCTGACGGCGTACAT
CAAGAAGCACATCTACGATCCCATGTGTTTTGCGGACGCCAAGGGCCGTCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail