Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1266
Gene name
LocationContig_1278:2692..4379
Strand-
Gene length (bp)1687
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 2.4E-18 46 187
PF08031 BBE Berberine and berberine like 7.4E-08 450 493

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 5 505 6.0E-147
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 24 496 2.0E-58
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 38 219 7.0E-10
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 112 487 2.0E-09
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 50 247 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 5 505 6.0E-147
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 24 496 2.0E-58
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 38 219 7.0E-10
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 112 487 2.0E-09
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 50 247 3.0E-07
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 20 229 5.0E-07
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 50 229 6.0E-07
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 50 229 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1266
MPRPEPGAVQWTNWEAWPERNESCFFDSPRDIPCRQGRVSLYSALVEAPGHIQAAVRFAAKHRLRLAIKNSGHCF
LGRSSAPESLQISTHKLKSIRFTSRFLPAGAPRGQAHEGPAVTVGAGVGLKELYSAVARRNLTVVAGLAHTVGIA
GGYIQGGGHSPLGNWKGMGSDNALEFRVVNAKGDLIVANDHQNRDLFWALRGGGGGTYGVVVSVAVRTFPDVPMV
GTEFGFAVPKGDLPAYWDMVEVFHTHLNSISDAGGCGYYSVAPKPQAQNGTEVLLLSGGFLFLNESRTETARKAM
DPLVADMRRLAAPGSTYRVDAVPRVSEWFDIALKGDADTTGGILLSGSRLVSRNFLSRNDGPAHLSKALRSISES
MPAIGFLGHVVAGGAVARSTVDSALNPAWRRTVTHIAFGVDWNSTTPLVEQEAIRSQLTEIGVEGLRRLEPDMGA
YLNEADAYEKDFQRSFWGENYARLYDIKQEQDPFGLFIVRKGVGSEDWDDAGLCRVDNRGRLRRLPE*
Coding >Hirsu2|1266
ATGCCACGCCCCGAGCCCGGTGCGGTGCAGTGGACCAACTGGGAGGCATGGCCGGAGCGCAACGAGAGCTGTTTC
TTCGACAGCCCGAGAGACATACCCTGCCGCCAGGGCCGCGTCTCGCTCTACTCAGCCCTGGTCGAGGCGCCTGGC
CACATCCAGGCCGCCGTACGATTCGCGGCCAAGCACCGTCTCCGTCTTGCCATCAAGAACTCGGGCCACTGCTTC
CTGGGCCGCTCGTCCGCTCCCGAATCGCTGCAGATCTCAACCCACAAGCTGAAGAGCATCCGGTTCACCAGCCGC
TTCCTCCCGGCCGGTGCGCCTCGAGGCCAGGCCCACGAGGGCCCCGCCGTCACCGTTGGCGCCGGAGTCGGCCTC
AAGGAGCTGTACTCTGCCGTCGCGAGGCGCAATCTGACCGTCGTTGCAGGCCTGGCACACACTGTCGGTATTGCA
GGCGGCTACATCCAAGGCGGCGGCCATAGTCCGCTTGGAAACTGGAAAGGAATGGGCTCCGACAATGCTCTAGAG
TTTCGAGTCGTCAACGCCAAGGGAGATCTGATAGTGGCCAACGACCACCAAAACAGAGACCTGTTCTGGGCGCTG
CGAGGCGGCGGCGGCGGCACCTATGGCGTCGTCGTGAGCGTTGCGGTCCGGACCTTTCCCGACGTGCCCATGGTG
GGGACCGAGTTCGGATTTGCAGTCCCCAAGGGAGACCTGCCGGCTTACTGGGACATGGTAGAGGTCTTTCACACT
CACCTCAACAGCATATCGGATGCAGGCGGATGCGGCTACTACTCCGTCGCACCCAAGCCGCAGGCGCAGAACGGC
ACGGAAGTCCTCCTCCTTTCTGGCGGCTTCTTGTTCCTCAATGAAAGCCGGACGGAGACGGCTCGCAAGGCCATG
GATCCGTTGGTGGCAGACATGCGTCGACTTGCCGCGCCAGGCTCGACATATCGCGTCGACGCAGTGCCGCGAGTG
TCTGAGTGGTTCGACATTGCTCTCAAGGGGGATGCCGACACGACGGGAGGCATTCTCCTTTCCGGGTCCCGGCTG
GTCTCGCGCAACTTTCTCTCCCGAAACGACGGCCCTGCACACCTCAGCAAGGCCCTGCGGTCCATCAGCGAGAGC
ATGCCGGCCATTGGCTTCCTCGGCCACGTCGTCGCCGGCGGGGCCGTGGCCCGAAGCACAGTCGACTCAGCCTTG
AACCCGGCGTGGAGGAGGACGGTAACGCACATTGCCTTTGGTGTCGACTGGAACAGTACCACGCCTCTCGTGGAG
CAAGAAGCCATCCGCAGCCAGCTGACGGAAATCGGAGTCGAGGGGCTGCGACGCTTGGAACCGGACATGGGGGCG
TATCTCAACGAGGCGGACGCCTATGAGAAGGACTTTCAGCGGTCTTTTTGGGGCGAAAACTACGCGCGCTTGTAC
GACATCAAGCAGGAGCAGGACCCTTTCGGCCTGTTCATCGTGCGCAAGGGGGTGGGTAGCGAAGATTGGGATGAC
GCCGGTCTCTGCAGGGTCGACAACAGAGGCCGGCTCCGTCGCCTGCCGGAATAG
Transcript >Hirsu2|1266
ATGCCACGCCCCGAGCCCGGTGCGGTGCAGTGGACCAACTGGGAGGCATGGCCGGAGCGCAACGAGAGCTGTTTC
TTCGACAGCCCGAGAGACATACCCTGCCGCCAGGGCCGCGTCTCGCTCTACTCAGCCCTGGTCGAGGCGCCTGGC
CACATCCAGGCCGCCGTACGATTCGCGGCCAAGCACCGTCTCCGTCTTGCCATCAAGAACTCGGGCCACTGCTTC
CTGGGCCGCTCGTCCGCTCCCGAATCGCTGCAGATCTCAACCCACAAGCTGAAGAGCATCCGGTTCACCAGCCGC
TTCCTCCCGGCCGGTGCGCCTCGAGGCCAGGCCCACGAGGGCCCCGCCGTCACCGTTGGCGCCGGAGTCGGCCTC
AAGGAGCTGTACTCTGCCGTCGCGAGGCGCAATCTGACCGTCGTTGCAGGCCTGGCACACACTGTCGGTATTGCA
GGCGGCTACATCCAAGGCGGCGGCCATAGTCCGCTTGGAAACTGGAAAGGAATGGGCTCCGACAATGCTCTAGAG
TTTCGAGTCGTCAACGCCAAGGGAGATCTGATAGTGGCCAACGACCACCAAAACAGAGACCTGTTCTGGGCGCTG
CGAGGCGGCGGCGGCGGCACCTATGGCGTCGTCGTGAGCGTTGCGGTCCGGACCTTTCCCGACGTGCCCATGGTG
GGGACCGAGTTCGGATTTGCAGTCCCCAAGGGAGACCTGCCGGCTTACTGGGACATGGTAGAGGTCTTTCACACT
CACCTCAACAGCATATCGGATGCAGGCGGATGCGGCTACTACTCCGTCGCACCCAAGCCGCAGGCGCAGAACGGC
ACGGAAGTCCTCCTCCTTTCTGGCGGCTTCTTGTTCCTCAATGAAAGCCGGACGGAGACGGCTCGCAAGGCCATG
GATCCGTTGGTGGCAGACATGCGTCGACTTGCCGCGCCAGGCTCGACATATCGCGTCGACGCAGTGCCGCGAGTG
TCTGAGTGGTTCGACATTGCTCTCAAGGGGGATGCCGACACGACGGGAGGCATTCTCCTTTCCGGGTCCCGGCTG
GTCTCGCGCAACTTTCTCTCCCGAAACGACGGCCCTGCACACCTCAGCAAGGCCCTGCGGTCCATCAGCGAGAGC
ATGCCGGCCATTGGCTTCCTCGGCCACGTCGTCGCCGGCGGGGCCGTGGCCCGAAGCACAGTCGACTCAGCCTTG
AACCCGGCGTGGAGGAGGACGGTAACGCACATTGCCTTTGGTGTCGACTGGAACAGTACCACGCCTCTCGTGGAG
CAAGAAGCCATCCGCAGCCAGCTGACGGAAATCGGAGTCGAGGGGCTGCGACGCTTGGAACCGGACATGGGGGCG
TATCTCAACGAGGCGGACGCCTATGAGAAGGACTTTCAGCGGTCTTTTTGGGGCGAAAACTACGCGCGCTTGTAC
GACATCAAGCAGGAGCAGGACCCTTTCGGCCTGTTCATCGTGCGCAAGGGGGTGGGTAGCGAAGATTGGGATGAC
GCCGGTCTCTGCAGGGTCGACAACAGAGGCCGGCTCCGTCGCCTGCCGGAATAG
Gene >Hirsu2|1266
ATGCCACGCCCCGAGGTTTGATTCCGTTGCCTGCAACGCGTCCGCGGCCAAGTCTCCCGACTCTCTCTGGCGTGC
CTCGCAGCCCGGTGCGGTGCAGTGGACCAACTGGGAGGCATGGCCGGAGCGCAACGAGAGCTGTTTCTTCGACAG
CCCGAGAGACATACCCTGCCGCCAGGGCCGCGTCTCGCTCTACTCAGCCCTGGTCGAGGCGCCTGGCCACATCCA
GGCCGCCGTACGATTCGCGGCCAAGCACCGTCTCCGTCTTGCCATCAAGAACTCGGGCCACTGCTTCCTGGGCCG
CTCGTCCGCTCCCGAATCGCTGCAGATCTCAACCCACAAGCTGAAGAGCATCCGGTTCACCAGCCGCTTCCTCCC
GGCCGGTGCGCCTCGAGGCCAGGCCCACGAGGGCCCCGCCGTCACCGTTGGCGCCGGAGTCGGCCTCAAGGAGCT
GTACTCTGCCGTCGCGAGGCGCAATCTGACCGTCGTTGCAGGCCTGGCACACACTGTCGGTATTGCAGGCGGCTA
CATCCAAGGCGGCGGCCATAGTCCGCTTGGAAACTGGAAAGGAATGGGCTCCGACAATGCTCTAGAGTTTCGAGT
CGTCAACGCCAAGGTTGGCCGCTCGACCCGCAAAAAGTGCCCCGTGAATTTATGCTGACCCTTGCATCTCGCCGG
GAAGGGAGATCTGATAGTGGCCAACGACCACCAAAACAGAGACCTGTTCTGGGCGCTGCGAGGCGGCGGCGGCGG
CACCTATGGCGTCGTCGTGAGCGTTGCGGTCCGGACCTTTCCCGACGTGCCCATGGTGGGGACCGAGTTCGGATT
TGCAGTCCCCAAGGGAGACCTGCCGGCTTACTGGGACATGGTAGAGGTCTTTCACACTCACCTCAACAGCATATC
GGATGCAGGCGGATGCGGCTACTACTCCGTCGCACCCAAGCCGCAGGCGCAGAACGGCACGGAAGTCCTCCTCCT
TTCTGGCGGCTTCTTGTTCCTCAATGAAAGCCGGACGGAGACGGCTCGCAAGGCCATGGATCCGTTGGTGGCAGA
CATGCGTCGACTTGCCGCGCCAGGCTCGACATATCGCGTCGACGCAGTGCCGCGAGTGTCTGAGTGGTTCGACAT
TGCTCTCAAGGGGGATGCCGACACGACGGGAGGCATTCTCCTTTCCGGGTCCCGGCTGGTCTCGCGCAACTTTCT
CTCCCGAAACGACGGCCCTGCACACCTCAGCAAGGCCCTGCGGTCCATCAGCGAGAGCATGCCGGCCATTGGCTT
CCTCGGCCACGTCGTCGCCGGCGGGGCCGTGGCCCGAAGCACAGTCGACTCAGCCTTGAACCCGGCGTGGAGGAG
GACGGTAACGCACATTGCCTTTGGTGTCGACTGGAACAGTACCACGCCTCTCGTGGAGCAAGAAGCCATCCGCAG
CCAGCTGACGGAAATCGGAGTCGAGGGGCTGCGACGCTTGGAACCGGACATGGGGGCGTATCTCAACGAGGCGGA
CGCCTATGAGAAGGACTTTCAGCGGTCTTTTTGGGGCGAAAACTACGCGCGCTTGTACGACATCAAGCAGGAGCA
GGACCCTTTCGGCCTGTTCATCGTGCGCAAGGGGGTGGGTAGCGAAGATTGGGATGACGCCGGTCTCTGCAGGGT
CGACAACAGAGGCCGGCTCCGTCGCCTGCCGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail