Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1266
Gene name
LocationContig_1278:2692..4379
Strand-
Gene length (bp)1687
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.2E-18 46 187
PF08031 BBE Berberine and berberine like 8.1E-08 450 493

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 5 505 6.0E-147
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 24 496 2.0E-58
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 38 219 7.0E-10
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 112 487 2.0E-09
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 50 247 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 5 505 6.0E-147
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 24 496 2.0E-58
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 38 219 7.0E-10
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 112 487 2.0E-09
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 50 247 3.0E-07
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 20 229 5.0E-07
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 50 229 6.0E-07
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 50 229 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Peroxisomal targeting signal 0.4487 0.2525 0.599 0.0624 0.0969 0.1833 0.0359 0.1606 0.0327 0.5282

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA7 2.3E-51 47 488

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup66
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|811
Ophiocordyceps australis 1348a (Ghana) OphauG2|680
Ophiocordyceps australis 1348a (Ghana) OphauG2|3664
Ophiocordyceps australis 1348a (Ghana) OphauG2|209
Ophiocordyceps australis 1348a (Ghana) OphauG2|1497
Ophiocordyceps australis map64 (Brazil) OphauB2|4301
Ophiocordyceps australis map64 (Brazil) OphauB2|1761
Ophiocordyceps australis map64 (Brazil) OphauB2|3700
Ophiocordyceps australis map64 (Brazil) OphauB2|4040
Ophiocordyceps australis map64 (Brazil) OphauB2|708
Ophiocordyceps australis map64 (Brazil) OphauB2|803
Ophiocordyceps camponoti-floridani Ophcf2|02634
Ophiocordyceps camponoti-rufipedis Ophun1|6991
Ophiocordyceps subramaniannii Hirsu2|7149
Ophiocordyceps subramaniannii Hirsu2|3128
Ophiocordyceps subramaniannii Hirsu2|1266 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9345
Ophiocordyceps subramaniannii Hirsu2|10563

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1266
MPRPEPGAVQWTNWEAWPERNESCFFDSPRDIPCRQGRVSLYSALVEAPGHIQAAVRFAAKHRLRLAIKNSGHCF
LGRSSAPESLQISTHKLKSIRFTSRFLPAGAPRGQAHEGPAVTVGAGVGLKELYSAVARRNLTVVAGLAHTVGIA
GGYIQGGGHSPLGNWKGMGSDNALEFRVVNAKGDLIVANDHQNRDLFWALRGGGGGTYGVVVSVAVRTFPDVPMV
GTEFGFAVPKGDLPAYWDMVEVFHTHLNSISDAGGCGYYSVAPKPQAQNGTEVLLLSGGFLFLNESRTETARKAM
DPLVADMRRLAAPGSTYRVDAVPRVSEWFDIALKGDADTTGGILLSGSRLVSRNFLSRNDGPAHLSKALRSISES
MPAIGFLGHVVAGGAVARSTVDSALNPAWRRTVTHIAFGVDWNSTTPLVEQEAIRSQLTEIGVEGLRRLEPDMGA
YLNEADAYEKDFQRSFWGENYARLYDIKQEQDPFGLFIVRKGVGSEDWDDAGLCRVDNRGRLRRLPE*
Coding >Hirsu2|1266
ATGCCACGCCCCGAGCCCGGTGCGGTGCAGTGGACCAACTGGGAGGCATGGCCGGAGCGCAACGAGAGCTGTTTC
TTCGACAGCCCGAGAGACATACCCTGCCGCCAGGGCCGCGTCTCGCTCTACTCAGCCCTGGTCGAGGCGCCTGGC
CACATCCAGGCCGCCGTACGATTCGCGGCCAAGCACCGTCTCCGTCTTGCCATCAAGAACTCGGGCCACTGCTTC
CTGGGCCGCTCGTCCGCTCCCGAATCGCTGCAGATCTCAACCCACAAGCTGAAGAGCATCCGGTTCACCAGCCGC
TTCCTCCCGGCCGGTGCGCCTCGAGGCCAGGCCCACGAGGGCCCCGCCGTCACCGTTGGCGCCGGAGTCGGCCTC
AAGGAGCTGTACTCTGCCGTCGCGAGGCGCAATCTGACCGTCGTTGCAGGCCTGGCACACACTGTCGGTATTGCA
GGCGGCTACATCCAAGGCGGCGGCCATAGTCCGCTTGGAAACTGGAAAGGAATGGGCTCCGACAATGCTCTAGAG
TTTCGAGTCGTCAACGCCAAGGGAGATCTGATAGTGGCCAACGACCACCAAAACAGAGACCTGTTCTGGGCGCTG
CGAGGCGGCGGCGGCGGCACCTATGGCGTCGTCGTGAGCGTTGCGGTCCGGACCTTTCCCGACGTGCCCATGGTG
GGGACCGAGTTCGGATTTGCAGTCCCCAAGGGAGACCTGCCGGCTTACTGGGACATGGTAGAGGTCTTTCACACT
CACCTCAACAGCATATCGGATGCAGGCGGATGCGGCTACTACTCCGTCGCACCCAAGCCGCAGGCGCAGAACGGC
ACGGAAGTCCTCCTCCTTTCTGGCGGCTTCTTGTTCCTCAATGAAAGCCGGACGGAGACGGCTCGCAAGGCCATG
GATCCGTTGGTGGCAGACATGCGTCGACTTGCCGCGCCAGGCTCGACATATCGCGTCGACGCAGTGCCGCGAGTG
TCTGAGTGGTTCGACATTGCTCTCAAGGGGGATGCCGACACGACGGGAGGCATTCTCCTTTCCGGGTCCCGGCTG
GTCTCGCGCAACTTTCTCTCCCGAAACGACGGCCCTGCACACCTCAGCAAGGCCCTGCGGTCCATCAGCGAGAGC
ATGCCGGCCATTGGCTTCCTCGGCCACGTCGTCGCCGGCGGGGCCGTGGCCCGAAGCACAGTCGACTCAGCCTTG
AACCCGGCGTGGAGGAGGACGGTAACGCACATTGCCTTTGGTGTCGACTGGAACAGTACCACGCCTCTCGTGGAG
CAAGAAGCCATCCGCAGCCAGCTGACGGAAATCGGAGTCGAGGGGCTGCGACGCTTGGAACCGGACATGGGGGCG
TATCTCAACGAGGCGGACGCCTATGAGAAGGACTTTCAGCGGTCTTTTTGGGGCGAAAACTACGCGCGCTTGTAC
GACATCAAGCAGGAGCAGGACCCTTTCGGCCTGTTCATCGTGCGCAAGGGGGTGGGTAGCGAAGATTGGGATGAC
GCCGGTCTCTGCAGGGTCGACAACAGAGGCCGGCTCCGTCGCCTGCCGGAATAG
Transcript >Hirsu2|1266
ATGCCACGCCCCGAGCCCGGTGCGGTGCAGTGGACCAACTGGGAGGCATGGCCGGAGCGCAACGAGAGCTGTTTC
TTCGACAGCCCGAGAGACATACCCTGCCGCCAGGGCCGCGTCTCGCTCTACTCAGCCCTGGTCGAGGCGCCTGGC
CACATCCAGGCCGCCGTACGATTCGCGGCCAAGCACCGTCTCCGTCTTGCCATCAAGAACTCGGGCCACTGCTTC
CTGGGCCGCTCGTCCGCTCCCGAATCGCTGCAGATCTCAACCCACAAGCTGAAGAGCATCCGGTTCACCAGCCGC
TTCCTCCCGGCCGGTGCGCCTCGAGGCCAGGCCCACGAGGGCCCCGCCGTCACCGTTGGCGCCGGAGTCGGCCTC
AAGGAGCTGTACTCTGCCGTCGCGAGGCGCAATCTGACCGTCGTTGCAGGCCTGGCACACACTGTCGGTATTGCA
GGCGGCTACATCCAAGGCGGCGGCCATAGTCCGCTTGGAAACTGGAAAGGAATGGGCTCCGACAATGCTCTAGAG
TTTCGAGTCGTCAACGCCAAGGGAGATCTGATAGTGGCCAACGACCACCAAAACAGAGACCTGTTCTGGGCGCTG
CGAGGCGGCGGCGGCGGCACCTATGGCGTCGTCGTGAGCGTTGCGGTCCGGACCTTTCCCGACGTGCCCATGGTG
GGGACCGAGTTCGGATTTGCAGTCCCCAAGGGAGACCTGCCGGCTTACTGGGACATGGTAGAGGTCTTTCACACT
CACCTCAACAGCATATCGGATGCAGGCGGATGCGGCTACTACTCCGTCGCACCCAAGCCGCAGGCGCAGAACGGC
ACGGAAGTCCTCCTCCTTTCTGGCGGCTTCTTGTTCCTCAATGAAAGCCGGACGGAGACGGCTCGCAAGGCCATG
GATCCGTTGGTGGCAGACATGCGTCGACTTGCCGCGCCAGGCTCGACATATCGCGTCGACGCAGTGCCGCGAGTG
TCTGAGTGGTTCGACATTGCTCTCAAGGGGGATGCCGACACGACGGGAGGCATTCTCCTTTCCGGGTCCCGGCTG
GTCTCGCGCAACTTTCTCTCCCGAAACGACGGCCCTGCACACCTCAGCAAGGCCCTGCGGTCCATCAGCGAGAGC
ATGCCGGCCATTGGCTTCCTCGGCCACGTCGTCGCCGGCGGGGCCGTGGCCCGAAGCACAGTCGACTCAGCCTTG
AACCCGGCGTGGAGGAGGACGGTAACGCACATTGCCTTTGGTGTCGACTGGAACAGTACCACGCCTCTCGTGGAG
CAAGAAGCCATCCGCAGCCAGCTGACGGAAATCGGAGTCGAGGGGCTGCGACGCTTGGAACCGGACATGGGGGCG
TATCTCAACGAGGCGGACGCCTATGAGAAGGACTTTCAGCGGTCTTTTTGGGGCGAAAACTACGCGCGCTTGTAC
GACATCAAGCAGGAGCAGGACCCTTTCGGCCTGTTCATCGTGCGCAAGGGGGTGGGTAGCGAAGATTGGGATGAC
GCCGGTCTCTGCAGGGTCGACAACAGAGGCCGGCTCCGTCGCCTGCCGGAATAG
Gene >Hirsu2|1266
ATGCCACGCCCCGAGGTTTGATTCCGTTGCCTGCAACGCGTCCGCGGCCAAGTCTCCCGACTCTCTCTGGCGTGC
CTCGCAGCCCGGTGCGGTGCAGTGGACCAACTGGGAGGCATGGCCGGAGCGCAACGAGAGCTGTTTCTTCGACAG
CCCGAGAGACATACCCTGCCGCCAGGGCCGCGTCTCGCTCTACTCAGCCCTGGTCGAGGCGCCTGGCCACATCCA
GGCCGCCGTACGATTCGCGGCCAAGCACCGTCTCCGTCTTGCCATCAAGAACTCGGGCCACTGCTTCCTGGGCCG
CTCGTCCGCTCCCGAATCGCTGCAGATCTCAACCCACAAGCTGAAGAGCATCCGGTTCACCAGCCGCTTCCTCCC
GGCCGGTGCGCCTCGAGGCCAGGCCCACGAGGGCCCCGCCGTCACCGTTGGCGCCGGAGTCGGCCTCAAGGAGCT
GTACTCTGCCGTCGCGAGGCGCAATCTGACCGTCGTTGCAGGCCTGGCACACACTGTCGGTATTGCAGGCGGCTA
CATCCAAGGCGGCGGCCATAGTCCGCTTGGAAACTGGAAAGGAATGGGCTCCGACAATGCTCTAGAGTTTCGAGT
CGTCAACGCCAAGGTTGGCCGCTCGACCCGCAAAAAGTGCCCCGTGAATTTATGCTGACCCTTGCATCTCGCCGG
GAAGGGAGATCTGATAGTGGCCAACGACCACCAAAACAGAGACCTGTTCTGGGCGCTGCGAGGCGGCGGCGGCGG
CACCTATGGCGTCGTCGTGAGCGTTGCGGTCCGGACCTTTCCCGACGTGCCCATGGTGGGGACCGAGTTCGGATT
TGCAGTCCCCAAGGGAGACCTGCCGGCTTACTGGGACATGGTAGAGGTCTTTCACACTCACCTCAACAGCATATC
GGATGCAGGCGGATGCGGCTACTACTCCGTCGCACCCAAGCCGCAGGCGCAGAACGGCACGGAAGTCCTCCTCCT
TTCTGGCGGCTTCTTGTTCCTCAATGAAAGCCGGACGGAGACGGCTCGCAAGGCCATGGATCCGTTGGTGGCAGA
CATGCGTCGACTTGCCGCGCCAGGCTCGACATATCGCGTCGACGCAGTGCCGCGAGTGTCTGAGTGGTTCGACAT
TGCTCTCAAGGGGGATGCCGACACGACGGGAGGCATTCTCCTTTCCGGGTCCCGGCTGGTCTCGCGCAACTTTCT
CTCCCGAAACGACGGCCCTGCACACCTCAGCAAGGCCCTGCGGTCCATCAGCGAGAGCATGCCGGCCATTGGCTT
CCTCGGCCACGTCGTCGCCGGCGGGGCCGTGGCCCGAAGCACAGTCGACTCAGCCTTGAACCCGGCGTGGAGGAG
GACGGTAACGCACATTGCCTTTGGTGTCGACTGGAACAGTACCACGCCTCTCGTGGAGCAAGAAGCCATCCGCAG
CCAGCTGACGGAAATCGGAGTCGAGGGGCTGCGACGCTTGGAACCGGACATGGGGGCGTATCTCAACGAGGCGGA
CGCCTATGAGAAGGACTTTCAGCGGTCTTTTTGGGGCGAAAACTACGCGCGCTTGTACGACATCAAGCAGGAGCA
GGACCCTTTCGGCCTGTTCATCGTGCGCAAGGGGGTGGGTAGCGAAGATTGGGATGACGCCGGTCTCTGCAGGGT
CGACAACAGAGGCCGGCTCCGTCGCCTGCCGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail