Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1260
Gene name
LocationContig_1276:2884..3649
Strand-
Gene length (bp)765
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10187 FAM192A_Fyv6_N FAM192A/Fyv6, N-terminal domain 1.0E-22 36 112

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3551 0.8702 0.0314 0.0161 0.0257 0.0013 0.0624 0.0421 0.0445 0.0041

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1609
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3558
Ophiocordyceps australis map64 (Brazil) OphauB2|5472
Ophiocordyceps camponoti-floridani Ophcf2|04660
Ophiocordyceps camponoti-rufipedis Ophun1|2747
Ophiocordyceps kimflemingae Ophio5|4255
Ophiocordyceps subramaniannii Hirsu2|1260 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1260
MSNRFVSGGTIGAAAEQKEDEDEAKQTTEAARPPPAKGAAEWEAVQQELEADRRRREEARRRAAGGEERTLYDIL
QANKAAKQAAFEEKHKIKNQFRPLDDDEADFLDERRASGAPPDGPEAEAEAWSVGRKRKRAGAARDKDVRAVRRA
ASGAEEAEPPPARRASALVDYGSDDGEDE*
Coding >Hirsu2|1260
ATGTCGAACCGCTTCGTGTCCGGCGGCACGATAGGCGCCGCCGCCGAGCAGAAGGAGGACGAGGACGAAGCGAAG
CAGACGACGGAGGCCGCGAGGCCGCCGCCGGCCAAGGGCGCGGCCGAGTGGGAGGCGGTCCAGCAGGAGCTGGAG
GCGGACCGGCGCCGGCGCGAGGAGGCGAGGCGGCGGGCGGCGGGGGGGGAGGAGAGGACGCTTTATGACATTTTG
CAGGCTAACAAGGCCGCCAAGCAAGCAGCCTTCGAAGAGAAGCACAAGATCAAGAACCAGTTCCGGCCGCTCGAC
GACGACGAGGCCGACTTCCTCGACGAGCGCCGCGCCAGCGGCGCCCCGCCCGACGGCCCCGAGGCCGAGGCCGAG
GCGTGGAGCGTCGGCAGGAAGAGGAAGAGGGCCGGCGCCGCGCGCGACAAGGATGTCAGGGCCGTGAGGCGGGCG
GCGAGCGGCGCGGAGGAGGCGGAGCCGCCGCCGGCGAGGAGGGCGTCGGCCCTGGTCGACTACGGTTCTGACGAC
GGCGAGGATGAGTAG
Transcript >Hirsu2|1260
ATGTCGAACCGCTTCGTGTCCGGCGGCACGATAGGCGCCGCCGCCGAGCAGAAGGAGGACGAGGACGAAGCGAAG
CAGACGACGGAGGCCGCGAGGCCGCCGCCGGCCAAGGGCGCGGCCGAGTGGGAGGCGGTCCAGCAGGAGCTGGAG
GCGGACCGGCGCCGGCGCGAGGAGGCGAGGCGGCGGGCGGCGGGGGGGGAGGAGAGGACGCTTTATGACATTTTG
CAGGCTAACAAGGCCGCCAAGCAAGCAGCCTTCGAAGAGAAGCACAAGATCAAGAACCAGTTCCGGCCGCTCGAC
GACGACGAGGCCGACTTCCTCGACGAGCGCCGCGCCAGCGGCGCCCCGCCCGACGGCCCCGAGGCCGAGGCCGAG
GCGTGGAGCGTCGGCAGGAAGAGGAAGAGGGCCGGCGCCGCGCGCGACAAGGATGTCAGGGCCGTGAGGCGGGCG
GCGAGCGGCGCGGAGGAGGCGGAGCCGCCGCCGGCGAGGAGGGCGTCGGCCCTGGTCGACTACGGTTCTGACGAC
GGCGAGGATGAGTAG
Gene >Hirsu2|1260
ATGTCGAACCGCTTCGTGTCCGGCGGCACGATAGGCGCCGCCGCCGAGCAGAAGGAGGACGAGGACGAAGCGAAG
CAGACGACGGAGGCCGCGAGGCCGCCGCCGGCCAAGGGCGCGGCCGAGTGGGAGGCGGTCCAGCAGGAGCTGGAG
GCGGACCGGCGCCGGCGCGAGGAGGCGAGGCGGCGGGCGGCGGGGGGGGAGGAGAGGACGCTTTATGACATTTTG
CAGGCTAACAAGGGTTCGTCCTCGTTTTCTTTCTCGCCTGTTACTACTACTACACACTCTCTGTTACTACCACTC
CTCTCTCTCTCTCTCTCTGTCTCTCTCCTGTTACCACTACTCCCCCCCCTAAACCGAGAGGGAGCACGCAGCTGA
CGCGCCCCCCAGCCGCCAAGCAAGCAGCCTTCGAAGAGAAGCACAAGATCAAGAACCAGTTCCGGCCGCTCGACG
ACGACGAGGCCGACTTCCTCGACGAGGTGCGCGCGCGCATGGGGGACGACGGGGGGCGCGTCCGCCGCGAGCGAG
GAGGAACGCCTGCGCGCCTTCCGCCAGCGCCGCGCCAGCGGCGCCCCGCCCGACGGCCCCGAGGCCGAGGCCGAG
GCGTGGAGCGTCGGCAGGAAGAGGAAGAGGGCCGGCGCCGCGCGCGACAAGGATGTCAGGGCCGTGAGGCGGGCG
GCGAGCGGCGCGGAGGAGGCGGAGCCGCCGCCGGCGAGGAGGGCGTCGGCCCTGGTCGACTACGGTTCTGACGAC
GGCGAGGATGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail