Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1258
Gene name
LocationContig_1275:1379..2696
Strand-
Gene length (bp)1317
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00503 G-alpha G-protein alpha subunit 2.5E-124 14 342
PF00025 Arf ADP-ribosylation factor family 3.1E-10 177 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00580|GPA1_CRYPA Guanine nucleotide-binding protein subunit alpha OS=Cryphonectria parasitica PE=3 SV=3 1 353 0.0E+00
sp|O42784|GPA1_COLTR Guanine nucleotide-binding protein subunit alpha OS=Colletotrichum trifolii GN=CTG1 PE=2 SV=3 1 353 0.0E+00
sp|O13315|GPA1_MAGO7 Guanine nucleotide-binding protein subunit alpha OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MAGB PE=3 SV=4 1 353 0.0E+00
sp|Q05425|GPA1_NEUCR Guanine nucleotide-binding protein alpha-1 subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gna-1 PE=2 SV=1 1 353 0.0E+00
sp|O74259|GPA1_SPOS1 Guanine nucleotide-binding protein subunit alpha OS=Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) GN=SSG-1 PE=2 SV=4 1 353 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00580|GPA1_CRYPA Guanine nucleotide-binding protein subunit alpha OS=Cryphonectria parasitica PE=3 SV=3 1 353 0.0E+00
sp|O42784|GPA1_COLTR Guanine nucleotide-binding protein subunit alpha OS=Colletotrichum trifolii GN=CTG1 PE=2 SV=3 1 353 0.0E+00
sp|O13315|GPA1_MAGO7 Guanine nucleotide-binding protein subunit alpha OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MAGB PE=3 SV=4 1 353 0.0E+00
sp|Q05425|GPA1_NEUCR Guanine nucleotide-binding protein alpha-1 subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gna-1 PE=2 SV=1 1 353 0.0E+00
sp|O74259|GPA1_SPOS1 Guanine nucleotide-binding protein subunit alpha OS=Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) GN=SSG-1 PE=2 SV=4 1 353 0.0E+00
sp|O74227|GPA1_COCH4 Guanine nucleotide-binding protein subunit alpha OS=Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T) GN=CGA1 PE=3 SV=3 1 353 0.0E+00
sp|Q00743|GPA1_EMENI Guanine nucleotide-binding protein subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fadA PE=1 SV=3 1 353 0.0E+00
sp|P87032|GPA1_USTMA Guanine nucleotide-binding protein alpha-1 subunit OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GPA1 PE=3 SV=1 1 353 0.0E+00
sp|P30675|GPA1_COPCO Guanine nucleotide-binding protein subunit alpha OS=Coprinellus congregatus GN=CGP1 PE=2 SV=3 1 353 0.0E+00
sp|P04897|GNAI2_RAT Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Rattus norvegicus GN=Gnai2 PE=1 SV=3 1 352 4.0E-139
sp|B2RSH2|GNAI1_MOUSE Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Mus musculus GN=Gnai1 PE=1 SV=1 1 352 5.0E-139
sp|P63096|GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Homo sapiens GN=GNAI1 PE=1 SV=2 1 352 5.0E-139
sp|P63097|GNAI1_BOVIN Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Bos taurus GN=GNAI1 PE=2 SV=2 1 352 5.0E-139
sp|P38404|GNAO_LOCMI Guanine nucleotide-binding protein G(o) subunit alpha OS=Locusta migratoria PE=3 SV=1 1 352 6.0E-139
sp|P10824|GNAI1_RAT Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Rattus norvegicus GN=Gnai1 PE=1 SV=3 1 352 7.0E-139
sp|P51877|GNAO_PLATR Guanine nucleotide-binding protein G(o) subunit alpha OS=Planorbella trivolvis PE=2 SV=2 1 352 9.0E-139
sp|P30683|GNAO_LYMST Guanine nucleotide-binding protein G(o) subunit alpha OS=Lymnaea stagnalis PE=2 SV=3 1 352 1.0E-138
sp|O13055|GNAI2_ORYLA Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Oryzias latipes GN=gnai2 PE=2 SV=3 1 352 2.0E-138
sp|Q5RAD4|GNAI1_PONAB Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Pongo abelii GN=GNAI1 PE=2 SV=3 1 352 3.0E-138
sp|P04899|GNAI2_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Homo sapiens GN=GNAI2 PE=1 SV=3 1 352 3.0E-138
sp|P08754|GNAI3_HUMAN Guanine nucleotide-binding protein G(k) subunit alpha OS=Homo sapiens GN=GNAI3 PE=1 SV=3 1 352 5.0E-138
sp|P30676|GNAI_PATPE Guanine nucleotide-binding protein G(i) subunit alpha OS=Patiria pectinifera PE=1 SV=3 1 352 5.0E-138
sp|P38402|GNAI2_CAVPO Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Cavia porcellus GN=GNAI2 PE=2 SV=3 1 352 6.0E-138
sp|P08752|GNAI2_MOUSE Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Mus musculus GN=Gnai2 PE=1 SV=5 1 352 6.0E-138
sp|P38401|GNAI1_CAVPO Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Cavia porcellus GN=GNAI1 PE=2 SV=3 1 352 8.0E-138
sp|Q4R592|GNAI2_MACFA Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Macaca fascicularis GN=GNAI2 PE=2 SV=3 1 352 1.0E-137
sp|P38400|GNAI2_CANLF Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Canis lupus familiaris GN=GNAI2 PE=2 SV=2 1 352 3.0E-137
sp|P50146|GNAI1_CHICK Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Gallus gallus GN=GNAI1 PE=2 SV=2 1 352 4.0E-137
sp|P10825|GNAO_XENLA Guanine nucleotide-binding protein G(o) subunit alpha OS=Xenopus laevis GN=gna0 PE=2 SV=5 1 352 4.0E-137
sp|P27044|GNAI1_XENLA Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Xenopus laevis GN=gnai1 PE=2 SV=3 1 352 2.0E-136
sp|P50147|GNAI2_CHICK Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Gallus gallus GN=GNAI2 PE=2 SV=2 1 352 2.0E-136
sp|P87383|GNAI1_ORYLA Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Oryzias latipes GN=gnai1 PE=2 SV=3 1 352 3.0E-136
sp|Q9DC51|GNAI3_MOUSE Guanine nucleotide-binding protein G(k) subunit alpha OS=Mus musculus GN=Gnai3 PE=1 SV=3 1 352 6.0E-136
sp|P08239|GNAO_BOVIN Guanine nucleotide-binding protein G(o) subunit alpha OS=Bos taurus GN=GNAO1 PE=1 SV=4 1 352 7.0E-136
sp|P08753|GNAI3_RAT Guanine nucleotide-binding protein G(k) subunit alpha OS=Rattus norvegicus GN=Gnai3 PE=1 SV=3 1 352 8.0E-136
sp|P30682|GNAI_LYMST Guanine nucleotide-binding protein G(i) subunit alpha OS=Lymnaea stagnalis PE=2 SV=3 1 352 2.0E-135
sp|P0C7Q4|GNAT3_BOVIN Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Bos taurus GN=GNAT3 PE=1 SV=1 1 352 6.0E-135
sp|P38403|GNAI3_CAVPO Guanine nucleotide-binding protein G(k) subunit alpha OS=Cavia porcellus GN=GNAI3 PE=2 SV=3 1 352 7.0E-135
sp|O15976|GNAO_MIZYE Guanine nucleotide-binding protein G(o) subunit alpha OS=Mizuhopecten yessoensis GN=SCGOA PE=2 SV=3 1 352 9.0E-135
sp|P51876|GNAI_PLATR Guanine nucleotide-binding protein G(i) subunit alpha OS=Planorbella trivolvis PE=2 SV=2 1 352 1.0E-134
sp|P27045|GNAI3_XENLA Guanine nucleotide-binding protein G(k) subunit alpha (Fragment) OS=Xenopus laevis GN=gnai3 PE=2 SV=1 10 352 2.0E-134
sp|P59215|GNAO_RAT Guanine nucleotide-binding protein G(o) subunit alpha OS=Rattus norvegicus GN=Gnao1 PE=1 SV=2 1 352 2.0E-134
sp|P59216|GNAO_CRILO Guanine nucleotide-binding protein G(o) subunit alpha OS=Cricetulus longicaudatus GN=GNAO1 PE=2 SV=2 1 352 2.0E-134
sp|P09471|GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit alpha OS=Homo sapiens GN=GNAO1 PE=1 SV=4 1 352 3.0E-134
sp|P18872|GNAO_MOUSE Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus GN=Gnao1 PE=1 SV=3 1 352 3.0E-134
sp|P51875|GNAO_CAEEL Guanine nucleotide-binding protein G(o) subunit alpha OS=Caenorhabditis elegans GN=goa-1 PE=1 SV=3 1 352 4.0E-134
sp|P16378|GNAO_DROME G protein alpha o subunit OS=Drosophila melanogaster GN=Galphao PE=1 SV=1 1 352 2.0E-132
sp|P04696|GNAT2_BOVIN Guanine nucleotide-binding protein G(t) subunit alpha-2 OS=Bos taurus GN=GNAT2 PE=2 SV=3 1 352 6.0E-132
sp|P29348|GNAT3_RAT Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Rattus norvegicus GN=Gnat3 PE=1 SV=3 1 352 8.0E-132
sp|P41776|GNAI_HOMAM Guanine nucleotide-binding protein G(i) subunit alpha OS=Homarus americanus PE=2 SV=2 1 352 9.0E-132
sp|Q3V3I2|GNAT3_MOUSE Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Mus musculus GN=Gnat3 PE=1 SV=2 1 352 3.0E-131
sp|P20353|GNAI_DROME G protein alpha i subunit OS=Drosophila melanogaster GN=Galphai PE=1 SV=2 1 352 3.0E-131
sp|Q9N2V6|GPA16_CAEEL Guanine nucleotide-binding protein alpha-16 subunit OS=Caenorhabditis elegans GN=gpa-16 PE=1 SV=3 1 352 8.0E-131
sp|A8MTJ3|GNAT3_HUMAN Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Homo sapiens GN=GNAT3 PE=2 SV=2 1 352 1.0E-130
sp|P50149|GNAT2_MOUSE Guanine nucleotide-binding protein G(t) subunit alpha-2 OS=Mus musculus GN=Gnat2 PE=2 SV=2 1 352 6.0E-130
sp|P19087|GNAT2_HUMAN Guanine nucleotide-binding protein G(t) subunit alpha-2 OS=Homo sapiens GN=GNAT2 PE=2 SV=4 1 352 7.0E-130
sp|Q60XS3|GPA16_CAEBR Guanine nucleotide-binding protein alpha-16 subunit OS=Caenorhabditis briggsae GN=gpa-16 PE=3 SV=3 1 352 6.0E-129
sp|Q28300|GNAT1_CANLF Guanine nucleotide-binding protein G(t) subunit alpha-1 OS=Canis lupus familiaris GN=GNAT1 PE=2 SV=2 1 352 7.0E-129
sp|P20612|GNAT1_MOUSE Guanine nucleotide-binding protein G(t) subunit alpha-1 OS=Mus musculus GN=Gnat1 PE=1 SV=3 1 352 1.0E-128
sp|P04695|GNAT1_BOVIN Guanine nucleotide-binding protein G(t) subunit alpha-1 OS=Bos taurus GN=GNAT1 PE=1 SV=3 1 352 2.0E-128
sp|P11488|GNAT1_HUMAN Guanine nucleotide-binding protein G(t) subunit alpha-1 OS=Homo sapiens GN=GNAT1 PE=1 SV=5 1 352 2.0E-128
sp|P38407|GNAT_XENLA Guanine nucleotide-binding protein G(t) subunit alpha OS=Xenopus laevis GN=gnat PE=2 SV=2 1 352 2.0E-128
sp|Q18434|GPA17_CAEEL Guanine nucleotide-binding protein alpha-17 subunit OS=Caenorhabditis elegans GN=odr-3 PE=1 SV=1 1 353 2.0E-127
sp|Q86FX7|GPA17_CAEBR Guanine nucleotide-binding protein alpha-17 subunit OS=Caenorhabditis briggsae GN=odr-3 PE=3 SV=1 1 353 7.0E-127
sp|Q9BIG5|GPA4_CAEEL Guanine nucleotide-binding protein alpha-4 subunit OS=Caenorhabditis elegans GN=gpa-4 PE=2 SV=3 1 352 5.0E-126
sp|P28052|GPA3_CAEEL Guanine nucleotide-binding protein alpha-3 subunit OS=Caenorhabditis elegans GN=gpa-3 PE=1 SV=2 1 352 6.0E-124
sp|P53359|GNAO_MANSE Guanine nucleotide-binding protein G(o) subunit alpha OS=Manduca sexta PE=1 SV=2 1 352 1.0E-123
sp|O70443|GNAZ_MOUSE Guanine nucleotide-binding protein G(z) subunit alpha OS=Mus musculus GN=Gnaz PE=1 SV=4 1 352 4.0E-122
sp|Q60W52|GPA3_CAEBR Guanine nucleotide-binding protein alpha-3 subunit OS=Caenorhabditis briggsae GN=gpa-3 PE=3 SV=1 1 352 7.0E-122
sp|P21279|GNAQ_MOUSE Guanine nucleotide-binding protein G(q) subunit alpha OS=Mus musculus GN=Gnaq PE=1 SV=4 1 353 1.0E-121
sp|P19627|GNAZ_RAT Guanine nucleotide-binding protein G(z) subunit alpha OS=Rattus norvegicus GN=Gnaz PE=2 SV=3 1 352 1.0E-121
sp|P82471|GNAQ_RAT Guanine nucleotide-binding protein G(q) subunit alpha OS=Rattus norvegicus GN=Gnaq PE=2 SV=2 1 353 2.0E-121
sp|Q2PKF4|GNAQ_PIG Guanine nucleotide-binding protein G(q) subunit alpha OS=Sus scrofa GN=GNAQ PE=2 SV=3 1 353 3.0E-121
sp|P50148|GNAQ_HUMAN Guanine nucleotide-binding protein G(q) subunit alpha OS=Homo sapiens GN=GNAQ PE=1 SV=4 1 353 3.0E-121
sp|Q28294|GNAQ_CANLF Guanine nucleotide-binding protein G(q) subunit alpha OS=Canis lupus familiaris GN=GNAQ PE=2 SV=2 1 353 3.0E-121
sp|Q61B55|GPA4_CAEBR Guanine nucleotide-binding protein alpha-4 subunit OS=Caenorhabditis briggsae GN=gpa-4 PE=3 SV=3 1 352 3.0E-121
sp|P19086|GNAZ_HUMAN Guanine nucleotide-binding protein G(z) subunit alpha OS=Homo sapiens GN=GNAZ PE=2 SV=3 1 352 3.0E-120
sp|Q21917|GPA7_CAEEL Guanine nucleotide-binding protein alpha-7 subunit OS=Caenorhabditis elegans GN=gpa-7 PE=1 SV=1 1 352 3.0E-120
sp|Q9XZV3|GNAO_GEOCY Guanine nucleotide-binding protein G(o) subunit alpha OS=Geodia cydonium PE=2 SV=3 2 353 4.0E-120
sp|Q61MQ8|GPA7_CAEBR Guanine nucleotide-binding protein alpha-7 subunit OS=Caenorhabditis briggsae GN=gpa-7 PE=3 SV=1 1 352 9.0E-120
sp|Q9HFW7|GPA3_NEUCR Guanine nucleotide-binding protein alpha-3 subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gna-3 PE=3 SV=1 1 353 3.0E-119
sp|P0CN96|GPA1_CRYNJ Guanine nucleotide-binding protein subunit alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GPA1 PE=3 SV=1 8 353 6.0E-119
sp|P0CN97|GPA1_CRYNB Guanine nucleotide-binding protein subunit alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GPA1 PE=3 SV=1 8 353 6.0E-119
sp|P38412|GNAQ_LOLFO Guanine nucleotide-binding protein G(q) subunit alpha OS=Loligo forbesi PE=1 SV=1 1 353 6.0E-119
sp|P43444|GNA11_XENLA Guanine nucleotide-binding protein subunit alpha-11 OS=Xenopus laevis GN=gna11 PE=2 SV=1 1 353 9.0E-119
sp|P38410|GNAQ_XENLA Guanine nucleotide-binding protein G(q) subunit alpha OS=Xenopus laevis GN=gnaq PE=2 SV=2 1 353 2.0E-118
sp|P45645|GNA11_MELGA Guanine nucleotide-binding protein subunit alpha-11 OS=Meleagris gallopavo GN=GNA11 PE=1 SV=1 1 353 3.0E-118
sp|P29992|GNA11_HUMAN Guanine nucleotide-binding protein subunit alpha-11 OS=Homo sapiens GN=GNA11 PE=1 SV=2 1 353 6.0E-117
sp|Q05424|GPA2_NEUCR Guanine nucleotide-binding protein alpha-2 subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gna-2 PE=2 SV=1 4 348 8.0E-117
sp|Q2XSV9|GNA11_PIG Guanine nucleotide-binding protein subunit alpha-11 OS=Sus scrofa GN=GNA11 PE=2 SV=2 1 353 9.0E-117
sp|P38409|GNA11_BOVIN Guanine nucleotide-binding protein subunit alpha-11 OS=Bos taurus GN=GNA11 PE=2 SV=2 1 353 1.0E-116
sp|O95837|GNA14_HUMAN Guanine nucleotide-binding protein subunit alpha-14 OS=Homo sapiens GN=GNA14 PE=1 SV=1 3 353 1.0E-116
sp|P87033|GPA2_USTMA Guanine nucleotide-binding protein alpha-2 subunit OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GPA2 PE=3 SV=1 1 348 2.0E-116
sp|P21278|GNA11_MOUSE Guanine nucleotide-binding protein subunit alpha-11 OS=Mus musculus GN=Gna11 PE=1 SV=1 1 353 3.0E-116
sp|P91950|GNAQ_HOMAM Guanine nucleotide-binding protein G(q) subunit alpha OS=Homarus americanus PE=2 SV=1 1 353 5.0E-116
sp|P16894|GPA1_DICDI Guanine nucleotide-binding protein alpha-1 subunit OS=Dictyostelium discoideum GN=gpaA PE=2 SV=1 16 353 5.0E-116
sp|P38408|GNA14_BOVIN Guanine nucleotide-binding protein subunit alpha-14 OS=Bos taurus GN=GNA14 PE=2 SV=1 3 353 6.0E-116
sp|P30677|GNA14_MOUSE Guanine nucleotide-binding protein subunit alpha-14 OS=Mus musculus GN=Gna14 PE=1 SV=2 3 353 9.0E-116
sp|O73819|GNA14_XENLA Guanine nucleotide-binding protein subunit alpha-14 OS=Xenopus laevis GN=gna14 PE=2 SV=1 2 353 1.0E-115
sp|Q9JID2|GNA11_RAT Guanine nucleotide-binding protein subunit alpha-11 OS=Rattus norvegicus GN=Gna11 PE=2 SV=1 1 353 2.0E-115
sp|O14438|GPA3_USTHO Guanine nucleotide-binding protein alpha-3 subunit OS=Ustilago hordei GN=FIL1 PE=3 SV=1 1 353 8.0E-115
sp|P87034|GPA3_USTMA Guanine nucleotide-binding protein alpha-3 subunit OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GPA3 PE=1 SV=1 1 353 1.0E-114
sp|P38411|GNAQ_LYMST Guanine nucleotide-binding protein G(q) subunit alpha OS=Lymnaea stagnalis PE=2 SV=1 1 353 3.0E-114
sp|O15975|GNAQ_MIZYE Guanine nucleotide-binding protein G(q) subunit alpha OS=Mizuhopecten yessoensis GN=SCGQA PE=2 SV=1 1 353 4.0E-114
sp|P23625|GNAQ_DROME G protein alpha q subunit OS=Drosophila melanogaster GN=Galphaq PE=2 SV=2 1 348 2.0E-112
sp|P16051|GPA2_DICDI Guanine nucleotide-binding protein alpha-2 subunit OS=Dictyostelium discoideum GN=gpaB PE=1 SV=3 4 352 1.0E-110
sp|Q9XZV4|GNAQ_GEOCY Guanine nucleotide-binding protein G(q) subunit alpha OS=Geodia cydonium PE=2 SV=1 1 347 2.0E-109
sp|P22454|GPA2_CAEEL Guanine nucleotide-binding protein alpha-2 subunit OS=Caenorhabditis elegans GN=gpa-2 PE=2 SV=1 1 352 2.0E-97
sp|P34043|GPA5_DICDI Guanine nucleotide-binding protein alpha-5 subunit OS=Dictyostelium discoideum GN=gpaE PE=3 SV=2 1 344 1.0E-96
sp|P10823|GPA2_YEAST Guanine nucleotide-binding protein alpha-2 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPA2 PE=1 SV=2 33 353 1.0E-95
sp|P30679|GNA15_HUMAN Guanine nucleotide-binding protein subunit alpha-15 OS=Homo sapiens GN=GNA15 PE=1 SV=2 7 347 8.0E-95
sp|O88302|GNA15_RAT Guanine nucleotide-binding protein subunit alpha-15 OS=Rattus norvegicus GN=Gna15 PE=2 SV=1 7 347 5.0E-94
sp|P28051|GPA1_CAEEL Guanine nucleotide-binding protein alpha-1 subunit OS=Caenorhabditis elegans GN=gpa-1 PE=2 SV=2 1 352 6.0E-94
sp|Q60MJ0|GPA1_CAEBR Guanine nucleotide-binding protein alpha-1 subunit OS=Caenorhabditis briggsae GN=gpa-1 PE=3 SV=1 1 352 7.0E-94
sp|P27584|GPA1_SCHPO Guanine nucleotide-binding protein alpha-1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpa1 PE=3 SV=4 12 348 8.0E-94
sp|Q4VT35|GPA2_CAEBR Guanine nucleotide-binding protein alpha-2 subunit OS=Caenorhabditis briggsae GN=gpa-2 PE=3 SV=2 38 352 9.0E-94
sp|P91907|GPA15_CAEEL Guanine nucleotide-binding protein alpha-15 subunit OS=Caenorhabditis elegans GN=gpa-15 PE=2 SV=2 1 352 1.0E-93
sp|Q61DE0|GPA15_CAEBR Guanine nucleotide-binding protein alpha-15 subunit OS=Caenorhabditis briggsae GN=gpa-15 PE=3 SV=1 6 352 4.0E-93
sp|P27601|GNA13_MOUSE Guanine nucleotide-binding protein subunit alpha-13 OS=Mus musculus GN=Gna13 PE=1 SV=1 2 348 1.0E-92
sp|Q6Q7Y5|GNA13_RAT Guanine nucleotide-binding protein subunit alpha-13 OS=Rattus norvegicus GN=Gna13 PE=1 SV=1 2 348 2.0E-92
sp|P54111|GPA2_KLULA Guanine nucleotide-binding protein alpha-2 subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPA2 PE=3 SV=2 32 353 3.0E-92
sp|Q9TU29|GNA15_RABIT Guanine nucleotide-binding protein subunit alpha-15 OS=Oryctolagus cuniculus GN=GNA15 PE=2 SV=1 5 347 4.0E-92
sp|Q14344|GNA13_HUMAN Guanine nucleotide-binding protein subunit alpha-13 OS=Homo sapiens GN=GNA13 PE=1 SV=2 2 348 7.0E-92
sp|P34042|GPA4_DICDI Guanine nucleotide-binding protein alpha-4 subunit OS=Dictyostelium discoideum GN=gpaD PE=1 SV=1 11 347 2.0E-91
sp|P34044|GPA6_DICDI Guanine nucleotide-binding protein alpha-6 subunit OS=Dictyostelium discoideum GN=gpaF PE=2 SV=2 18 343 3.0E-88
sp|P28868|GPA1_CANAW Guanine nucleotide-binding protein subunit alpha OS=Candida albicans (strain WO-1) GN=CAG1 PE=3 SV=5 123 353 6.0E-88
sp|Q54R41|GPA9_DICDI Guanine nucleotide-binding protein alpha-9 subunit OS=Dictyostelium discoideum GN=gpaI PE=2 SV=1 1 349 1.0E-87
sp|Q9Y7B7|GPA1_KLULA Guanine nucleotide-binding protein alpha-1 subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPA1 PE=3 SV=4 122 353 1.0E-87
sp|P08539|GPA1_YEAST Guanine nucleotide-binding protein alpha-1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPA1 PE=1 SV=3 117 353 2.0E-87
sp|P27600|GNA12_MOUSE Guanine nucleotide-binding protein subunit alpha-12 OS=Mus musculus GN=Gna12 PE=1 SV=3 18 348 5.0E-87
sp|Q03113|GNA12_HUMAN Guanine nucleotide-binding protein subunit alpha-12 OS=Homo sapiens GN=GNA12 PE=1 SV=4 2 348 6.0E-87
sp|Q63210|GNA12_RAT Guanine nucleotide-binding protein subunit alpha-12 OS=Rattus norvegicus GN=Gna12 PE=1 SV=3 18 348 2.0E-86
sp|P30684|GNAS_LYMST Guanine nucleotide-binding protein G(s) subunit alpha OS=Lymnaea stagnalis PE=2 SV=1 1 348 5.0E-86
sp|P30678|GNA15_MOUSE Guanine nucleotide-binding protein subunit alpha-15 OS=Mus musculus GN=Gna15 PE=2 SV=1 7 347 1.0E-85
sp|P29797|GNAS_PIG Guanine nucleotide-binding protein G(s) subunit alpha OS=Sus scrofa GN=GNAS PE=2 SV=1 1 348 2.0E-85
sp|Q7PD79|GNAS_ANOGA Guanine nucleotide-binding protein G(s) subunit alpha OS=Anopheles gambiae GN=G-s-alpha-60A PE=2 SV=1 6 348 1.0E-84
sp|P24799|GNAS_XENLA Guanine nucleotide-binding protein G(s) subunit alpha OS=Xenopus laevis GN=gnas PE=2 SV=1 1 348 1.0E-83
sp|O16118|GNAS_HOMAM Guanine nucleotide-binding protein G(s) subunit alpha OS=Homarus americanus PE=2 SV=1 1 348 4.0E-83
sp|P63091|GNAS_CANLF Guanine nucleotide-binding protein G(s) subunit alpha OS=Canis lupus familiaris GN=GNAS PE=2 SV=1 1 348 1.0E-82
sp|P63092|GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Homo sapiens GN=GNAS PE=1 SV=1 1 348 1.0E-82
sp|P04896|GNAS2_BOVIN Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Bos taurus GN=GNAS PE=1 SV=1 1 348 2.0E-82
sp|P16052|GNAS_CRILO Guanine nucleotide-binding protein G(s) subunit alpha OS=Cricetulus longicaudatus GN=GNAS PE=2 SV=1 1 348 2.0E-82
sp|P63093|GNAS_MESAU Guanine nucleotide-binding protein G(s) subunit alpha OS=Mesocricetus auratus GN=GNAS PE=2 SV=1 1 348 2.0E-82
sp|P63095|GNAS2_RAT Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Rattus norvegicus GN=Gnas PE=1 SV=1 1 348 2.0E-82
sp|P63094|GNAS2_MOUSE Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Mus musculus GN=Gnas PE=1 SV=1 1 348 2.0E-82
sp|Q292P9|GNAS_DROPS Guanine nucleotide-binding protein G(s) subunit alpha OS=Drosophila pseudoobscura pseudoobscura GN=G-salpha60A PE=3 SV=1 6 348 3.0E-82
sp|Q8R4A8|GNAS_CRIGR Guanine nucleotide-binding protein G(s) subunit alpha OS=Cricetulus griseus GN=GNAS PE=2 SV=1 1 348 3.0E-82
sp|Q04665|GPA2_SCHPO Guanine nucleotide-binding protein alpha-2 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpa2 PE=1 SV=1 7 352 5.0E-82
sp|P20354|GNAS_DROME G protein alpha s subunit OS=Drosophila melanogaster GN=Galphas PE=2 SV=1 6 348 1.0E-81
sp|Q20907|GPA8_CAEEL Guanine nucleotide-binding protein alpha-8 subunit OS=Caenorhabditis elegans GN=gpa-8 PE=2 SV=1 8 352 3.0E-81
sp|Q19572|GPA12_CAEEL Guanine nucleotide-binding protein alpha-12 subunit OS=Caenorhabditis elegans GN=gpa-12 PE=1 SV=2 15 348 4.0E-81
sp|Q613V4|GPA12_CAEBR Guanine nucleotide-binding protein alpha-12 subunit OS=Caenorhabditis briggsae GN=gpa-12 PE=3 SV=1 15 348 6.0E-81
sp|P34046|GPA8_DICDI Guanine nucleotide-binding protein alpha-8 subunit OS=Dictyostelium discoideum GN=gpaH PE=2 SV=2 1 349 5.0E-79
sp|Q61MC6|GPA8_CAEBR Guanine nucleotide-binding protein alpha-8 subunit OS=Caenorhabditis briggsae GN=gpa-8 PE=3 SV=1 15 352 6.0E-79
sp|Q9BIG4|GPA10_CAEEL Guanine nucleotide-binding protein alpha-10 subunit OS=Caenorhabditis elegans GN=gpa-10 PE=2 SV=1 5 353 6.0E-79
sp|Q8CGK7|GNAL_MOUSE Guanine nucleotide-binding protein G(olf) subunit alpha OS=Mus musculus GN=Gnal PE=1 SV=1 1 348 2.0E-78
sp|P38405|GNAL_HUMAN Guanine nucleotide-binding protein G(olf) subunit alpha OS=Homo sapiens GN=GNAL PE=1 SV=1 1 348 5.0E-78
sp|Q6R0H7|GNAS1_MOUSE Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Mus musculus GN=Gnas PE=1 SV=1 5 348 2.0E-77
sp|P38406|GNAL_RAT Guanine nucleotide-binding protein G(olf) subunit alpha OS=Rattus norvegicus GN=Gnal PE=2 SV=2 1 348 2.0E-77
sp|O76584|GPA11_CAEEL Guanine nucleotide-binding protein alpha-11 subunit OS=Caenorhabditis elegans GN=gpa-11 PE=2 SV=2 15 353 2.0E-77
sp|Q63803|GNAS1_RAT Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Rattus norvegicus GN=Gnas PE=1 SV=3 5 348 2.0E-76
sp|P30669|GNAS_SCHMA Guanine nucleotide-binding protein G(s) subunit alpha OS=Schistosoma mansoni PE=2 SV=1 3 348 2.0E-76
sp|Q93743|GPA6_CAEEL Guanine nucleotide-binding protein alpha-6 subunit OS=Caenorhabditis elegans GN=gpa-6 PE=2 SV=2 2 352 7.0E-76
sp|Q9XZV5|GNAS_GEOCY Guanine nucleotide-binding protein G(s) subunit alpha OS=Geodia cydonium PE=2 SV=1 1 348 3.0E-75
sp|Q4VT31|GPA6_CAEBR Guanine nucleotide-binding protein alpha-6 subunit OS=Caenorhabditis briggsae GN=gpa-6 PE=3 SV=2 2 352 1.0E-73
sp|Q5JWF2|GNAS1_HUMAN Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Homo sapiens GN=GNAS PE=1 SV=2 13 348 9.0E-73
sp|Q4VT42|GPA10_CAEBR Guanine nucleotide-binding protein alpha-10 subunit OS=Caenorhabditis briggsae GN=gpa-10 PE=3 SV=2 2 353 9.0E-72
sp|P34045|GPA7_DICDI Guanine nucleotide-binding protein alpha-7 subunit OS=Dictyostelium discoideum GN=gpaG PE=2 SV=3 1 352 4.0E-71
sp|P25157|GNAL_DROME Guanine nucleotide-binding protein subunit alpha homolog OS=Drosophila melanogaster GN=cta PE=2 SV=1 6 347 1.0E-68
sp|Q20910|GPA9_CAEEL Guanine nucleotide-binding protein alpha-9 subunit OS=Caenorhabditis elegans GN=gpa-9 PE=3 SV=3 16 352 3.0E-68
sp|Q0DJ33|GPA1_ORYSJ Guanine nucleotide-binding protein alpha-1 subunit OS=Oryza sativa subsp. japonica GN=GPA1 PE=1 SV=2 14 316 6.0E-65
sp|A2Y3B5|GPA1_ORYSI Guanine nucleotide-binding protein alpha-1 subunit OS=Oryza sativa subsp. indica GN=GPA1 PE=2 SV=2 14 316 6.0E-65
sp|O04279|GPA2_PEA Guanine nucleotide-binding protein alpha-2 subunit OS=Pisum sativum GN=GPA2 PE=2 SV=1 11 353 1.0E-64
sp|O04278|GPA1_PEA Guanine nucleotide-binding protein alpha-1 subunit OS=Pisum sativum GN=GPA1 PE=2 SV=1 11 353 1.0E-64
sp|Q54KV6|GPA3_DICDI Guanine nucleotide-binding protein alpha-3 subunit OS=Dictyostelium discoideum GN=gpaC PE=3 SV=1 119 349 3.0E-64
sp|P26981|GPA1_SOLLC Guanine nucleotide-binding protein alpha-1 subunit OS=Solanum lycopersicum GN=GPA1 PE=2 SV=1 6 353 3.0E-64
sp|P18064|GPA1_ARATH Guanine nucleotide-binding protein alpha-1 subunit OS=Arabidopsis thaliana GN=GPA1 PE=1 SV=1 7 353 4.0E-64
sp|Q40224|GPA1_LUPLU Guanine nucleotide-binding protein alpha-1 subunit OS=Lupinus luteus GN=GPA1 PE=2 SV=1 11 353 6.0E-64
sp|P49082|GPA1_LOTJA Guanine nucleotide-binding protein alpha-1 subunit OS=Lotus japonicus GN=GPA1 PE=2 SV=1 11 353 2.0E-63
sp|Q05337|GNAF_DROME Guanine nucleotide-binding protein G(f) subunit alpha OS=Drosophila melanogaster GN=Galphaf PE=2 SV=1 27 352 2.0E-63
sp|P93163|GPA2_SOYBN Guanine nucleotide-binding protein alpha-2 subunit OS=Glycine max GN=GPA2 PE=2 SV=1 11 353 2.0E-63
sp|P52206|GNA11_CANLF Guanine nucleotide-binding protein subunit alpha-11 (Fragment) OS=Canis lupus familiaris GN=GNA11 PE=2 SV=1 38 236 3.0E-63
sp|P93564|GPA1_SOLTU Guanine nucleotide-binding protein alpha-1 subunit OS=Solanum tuberosum GN=GPA1 PE=2 SV=1 19 353 4.0E-62
sp|P49084|GPA1_SOYBN Guanine nucleotide-binding protein alpha-1 subunit OS=Glycine max GN=GPA1 PE=2 SV=1 11 283 5.0E-62
sp|Q4VT38|GPA14_CAEBR Guanine nucleotide-binding protein alpha-14 subunit OS=Caenorhabditis briggsae GN=gpa-14 PE=3 SV=2 7 352 2.0E-59
sp|Q54VG1|GPA12_DICDI Guanine nucleotide-binding protein alpha-12 subunit OS=Dictyostelium discoideum GN=gpaL PE=1 SV=1 40 338 3.0E-59
sp|Q9XTB2|GPA13_CAEEL Guanine nucleotide-binding protein alpha-13 subunit OS=Caenorhabditis elegans GN=gpa-13 PE=1 SV=2 1 331 1.0E-58
sp|Q4VT39|GPA13_CAEBR Guanine nucleotide-binding protein alpha-13 subunit OS=Caenorhabditis briggsae GN=gpa-13 PE=3 SV=1 1 338 3.0E-58
sp|Q9BIG2|GPA14_CAEEL Guanine nucleotide-binding protein alpha-14 subunit OS=Caenorhabditis elegans GN=gpa-14 PE=1 SV=2 7 352 2.0E-52
sp|Q86D96|GPA1_TRIVA Guanine nucleotide-binding protein subunit alpha-1 OS=Trichomonas vaginalis GN=GA1 PE=3 SV=1 36 308 1.0E-48
sp|P87035|GPA4_USTMA Guanine nucleotide-binding protein alpha-4 subunit OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GPA4 PE=3 SV=1 129 353 2.0E-45
sp|Q619V5|GPA5_CAEBR Guanine nucleotide-binding protein alpha-5 subunit OS=Caenorhabditis briggsae GN=gpa-5 PE=3 SV=1 1 352 1.0E-44
sp|Q20701|GPA5_CAEEL Guanine nucleotide-binding protein alpha-5 subunit OS=Caenorhabditis elegans GN=gpa-5 PE=2 SV=1 1 346 9.0E-42
sp|Q55EP5|GPA10_DICDI Guanine nucleotide-binding protein-like alpha-10 subunit OS=Dictyostelium discoideum GN=gpaJ PE=3 SV=1 18 343 4.0E-35
sp|P43151|GPA_LEIDO Putative guanine nucleotide-binding protein subunit alpha OS=Leishmania donovani PE=2 SV=1 13 205 4.0E-27
sp|Q8T130|GPA11_DICDI Guanine nucleotide-binding protein-like alpha-11 subunit OS=Dictyostelium discoideum GN=gpaK PE=3 SV=1 34 333 2.0E-26
sp|O15743|SPNA_DICDI Protein spalten OS=Dictyostelium discoideum GN=spnA PE=1 SV=1 36 332 4.0E-26
sp|O80462|XLG1_ARATH Extra-large guanine nucleotide-binding protein 1 OS=Arabidopsis thaliana GN=XLG1 PE=1 SV=2 26 290 2.0E-20
sp|Q9C516|XLG3_ARATH Extra-large guanine nucleotide-binding protein 3 OS=Arabidopsis thaliana GN=XLG3 PE=1 SV=1 35 290 9.0E-19
sp|P08539|GPA1_YEAST Guanine nucleotide-binding protein alpha-1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPA1 PE=1 SV=3 1 96 1.0E-18
sp|Q9Y7B7|GPA1_KLULA Guanine nucleotide-binding protein alpha-1 subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPA1 PE=3 SV=4 1 103 2.0E-17
sp|P28868|GPA1_CANAW Guanine nucleotide-binding protein subunit alpha OS=Candida albicans (strain WO-1) GN=CAG1 PE=3 SV=5 1 96 4.0E-16
sp|C6KIE6|XLG2_ARATH Extra-large guanine nucleotide-binding protein 2 OS=Arabidopsis thaliana GN=XLG2 PE=1 SV=1 35 290 2.0E-13
sp|Q60397|GNAI3_CRIGR Guanine nucleotide-binding protein G(k) subunit alpha (Fragment) OS=Cricetulus griseus GN=GNAI3 PE=3 SV=1 292 352 9.0E-13
sp|Q54KV6|GPA3_DICDI Guanine nucleotide-binding protein alpha-3 subunit OS=Dictyostelium discoideum GN=gpaC PE=3 SV=1 15 96 6.0E-11
sp|P87035|GPA4_USTMA Guanine nucleotide-binding protein alpha-4 subunit OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GPA4 PE=3 SV=1 35 101 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0005525 GTP binding Yes
GO:0019001 guanyl nucleotide binding Yes
GO:0031683 G-protein beta/gamma-subunit complex binding Yes
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0050794 regulation of cellular process No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0007165 signal transduction No
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0016462 pyrophosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0065007 biological regulation No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0032561 guanyl ribonucleotide binding No
GO:0044877 protein-containing complex binding No
GO:0097367 carbohydrate derivative binding No
GO:0050789 regulation of biological process No
GO:0017076 purine nucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Cell membrane 0.5523 0.2018 0.0531 0.6632 0.124 0.0051 0.1826 0.3771 0.286 0.0084

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1607
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6454
Ophiocordyceps australis map64 (Brazil) OphauB2|2076
Ophiocordyceps camponoti-floridani Ophcf2|01281
Ophiocordyceps camponoti-rufipedis Ophun1|2337
Ophiocordyceps kimflemingae Ophio5|1055
Ophiocordyceps subramaniannii Hirsu2|1258 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1258
MGCGMSTEEKEGKARNEEIENQLKRDKMMQRNEIKMLLLGAGESGKSTILKQMKLIHEGGYSRDERESFKEIIFS
NTVQSMRVILEAMESLELPLEDQRMEYHVQTIFMQPAQIEGDVLPPEVGGAIEALWKDRGVQECFKRSREYQLND
SARYYFDNINRIAAPDYMPNDQDVLRSRVKTTGITETTFIIGDLTYRMFDVGGQRSERKKWIHCFENVTTILFLV
AISEYDQLLFEDETVNRMQEALTLFDSICNSRWFIKTSIILFLNKIDRFKEKLPVSPMKNYFPDYEGGDDYAAAC
DYILNRFVSLNQHETKQIYTHFTCATDTTQIRFVMAAVNDIIIQENLRLCGLI*
Coding >Hirsu2|1258
ATGGGTTGTGGAATGAGCACGGAGGAGAAGGAGGGCAAGGCCCGCAACGAGGAGATTGAGAACCAGCTCAAGCGC
GACAAGATGATGCAGCGCAATGAGATCAAGATGCTTCTCCTCGGTGCCGGTGAATCGGGCAAGTCGACGATCCTC
AAGCAGATGAAGCTTATCCACGAAGGCGGCTACTCTCGCGACGAGCGGGAATCGTTCAAGGAGATCATCTTCAGC
AACACGGTACAGTCGATGCGCGTCATCCTCGAGGCCATGGAGTCGCTCGAGTTGCCGCTCGAGGACCAGCGCATG
GAGTACCACGTCCAGACCATCTTCATGCAGCCCGCGCAGATCGAGGGCGACGTGCTGCCCCCGGAGGTCGGCGGC
GCCATCGAGGCCCTGTGGAAGGATCGCGGCGTCCAAGAATGCTTCAAGCGGTCCCGCGAGTACCAGCTCAATGAC
TCGGCTCGATACTACTTCGACAACATCAACCGCATCGCCGCGCCCGACTACATGCCCAACGACCAGGACGTCCTG
CGCTCGCGAGTCAAGACGACGGGCATCACGGAGACGACGTTCATTATTGGCGATCTCACGTACCGTATGTTCGAC
GTCGGCGGCCAGCGATCCGAGCGCAAGAAGTGGATCCACTGCTTCGAAAACGTCACCACCATCCTCTTCCTCGTC
GCCATCTCCGAGTACGACCAGCTGCTGTTCGAGGACGAGACGGTCAACCGCATGCAGGAGGCCCTGACGCTCTTC
GACTCCATCTGCAACTCGCGCTGGTTCATCAAGACGTCCATCATTCTCTTCCTAAATAAGATCGACCGCTTCAAG
GAGAAGCTGCCCGTCAGCCCCATGAAGAACTACTTCCCCGACTACGAAGGCGGCGACGATTACGCCGCCGCCTGC
GACTACATCCTGAACCGATTCGTCAGCCTCAATCAGCACGAAACCAAGCAAATCTACACCCACTTCACCTGCGCC
ACCGACACCACCCAGATTCGCTTCGTCATGGCGGCCGTCAATGACATCATTATCCAAGAAAACCTCAGGCTGTGC
GGCCTCATCTAA
Transcript >Hirsu2|1258
ATGGGTTGTGGAATGAGCACGGAGGAGAAGGAGGGCAAGGCCCGCAACGAGGAGATTGAGAACCAGCTCAAGCGC
GACAAGATGATGCAGCGCAATGAGATCAAGATGCTTCTCCTCGGTGCCGGTGAATCGGGCAAGTCGACGATCCTC
AAGCAGATGAAGCTTATCCACGAAGGCGGCTACTCTCGCGACGAGCGGGAATCGTTCAAGGAGATCATCTTCAGC
AACACGGTACAGTCGATGCGCGTCATCCTCGAGGCCATGGAGTCGCTCGAGTTGCCGCTCGAGGACCAGCGCATG
GAGTACCACGTCCAGACCATCTTCATGCAGCCCGCGCAGATCGAGGGCGACGTGCTGCCCCCGGAGGTCGGCGGC
GCCATCGAGGCCCTGTGGAAGGATCGCGGCGTCCAAGAATGCTTCAAGCGGTCCCGCGAGTACCAGCTCAATGAC
TCGGCTCGATACTACTTCGACAACATCAACCGCATCGCCGCGCCCGACTACATGCCCAACGACCAGGACGTCCTG
CGCTCGCGAGTCAAGACGACGGGCATCACGGAGACGACGTTCATTATTGGCGATCTCACGTACCGTATGTTCGAC
GTCGGCGGCCAGCGATCCGAGCGCAAGAAGTGGATCCACTGCTTCGAAAACGTCACCACCATCCTCTTCCTCGTC
GCCATCTCCGAGTACGACCAGCTGCTGTTCGAGGACGAGACGGTCAACCGCATGCAGGAGGCCCTGACGCTCTTC
GACTCCATCTGCAACTCGCGCTGGTTCATCAAGACGTCCATCATTCTCTTCCTAAATAAGATCGACCGCTTCAAG
GAGAAGCTGCCCGTCAGCCCCATGAAGAACTACTTCCCCGACTACGAAGGCGGCGACGATTACGCCGCCGCCTGC
GACTACATCCTGAACCGATTCGTCAGCCTCAATCAGCACGAAACCAAGCAAATCTACACCCACTTCACCTGCGCC
ACCGACACCACCCAGATTCGCTTCGTCATGGCGGCCGTCAATGACATCATTATCCAAGAAAACCTCAGGCTGTGC
GGCCTCATCTAA
Gene >Hirsu2|1258
ATGGGTTGTGGAATGAGCACGGAGGAGAAGGAGGGCAAGGCCCGCAACGAGGAGATTGAGAACCAGCTCAAGCGC
GACAAGATGATGCAGCGCAATGAGATCAAGATGCTTCTCCTCGGTACGTCGGTCCCTCGATGCCTGCCTTGGCCC
TGGGCCGCCGGCCCTTCCCCTGGGCCGCGGCGCACCGGGAAGCTGCATCGTGTGCCTCGGAAGATGCCGACGCGT
ACGAGCATCCTGTCGCTGACCGGATGCAGGTGCCGGTGAATCGGGCAAGTCGACGATCCTCAAGCAGATGAAGCT
TATCCACGAAGGCGGCTACTCTCGCGACGAGCGGGAATCGTTCAAGGAGATCATCTTCAGCAACACGGTACAGTC
GATGCGCGTCATCCTCGAGGCCATGGAGTCGCTCGAGTTGCCGCTCGAGGACCAGCGCATGGAGTACCACGTCCA
GACCATCTTCATGCAGCCCGCGCAGATCGAGGGCGACGTGCTGCCCCCGGAGGTCGGCGGCGCCATCGAGGCCCT
GTGGAAGGATCGCGGCGTCCAAGAATGCTTCAAGCGGTCCCGCGAGTACCAGCTCAATGACTCGGCTCGATAGTA
AGTCGTCGCCACGCGTGCCCTCGGAACCCGTCTGCTGACCGGCCGCACAGCTACTTCGACAACATCAACCGCATC
GCCGCGCCCGACTACATGCCCAACGACCAGGACGTCCTGCGCTCGCGAGTCAAGACGACGGGCATCACGGAGACG
ACGTTCATTATTGGCGATCTCACGTACCGTATGTTCGACGTCGGCGGCCAGCGATCCGAGCGCAAGAAGTGGATC
CACTGCTTCGAAAACGTCACCACCATCCTCTTCCTCGTCGCCATCTCCGAGTACGACCAGCTGCTGTTCGAGGAC
GAGACGGTCAACCGCATGCAGGAGGCCCTGACGCTCTTCGACTCCATCTGCAACTCGCGCTGGTTCATCAAGACG
TCCATCATTCTCTTCCTAAATAAGATCGACCGCTTCAAGGAGAAGCTGCCCGTCAGCCCCATGAAGAACTACTTC
CCCGACTACGAAGGCGGCGACGATTACGCCGCCGCCTGCGACTACATCCTGAACCGATTCGTCAGCCTCAATCAG
CACGAAACCAAGCAAATCTACACCCACTTCACCTGCGCCACCGACACCACCCAGATTCGCTTCGTCATGGCGGCC
GTCAATGGTTAGTTACCCCCCCCCCCCTTCCCGTCTTGGCCGCAACTCCCGGTCGCTGACGCGATCGCCGCAGAC
ATCATTATCCAAGAAAACCTCAGGCTGTGCGGCCTCATCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail