Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1257
Gene name
LocationContig_1274:3929..6277
Strand+
Gene length (bp)2348
Transcript length (bp)2280
Coding sequence length (bp)2280
Protein length (aa) 760

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 1.3E-165 169 620
PF14558 TRP_N ML-like domain 4.6E-42 28 164

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 9 740 3.0E-141
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 20 620 2.0E-137
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 11 743 7.0E-135
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 22 623 9.0E-106
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 26 618 1.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 9 740 3.0E-141
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 20 620 2.0E-137
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 11 743 7.0E-135
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 22 623 9.0E-106
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 26 618 1.0E-103
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 36 558 7.0E-26
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 345 367 22
2 388 410 22
3 420 442 22
4 482 504 22
5 514 533 19
6 540 562 22
7 572 594 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1257
MRSFLKAPLLLLSSMAAMLSPASGERLLMSSSLNTCQQDSSFTASLFNVVYTPSNNSASINMVATSSVQGKVLFD
LAISAYGYQFLRMTLNPCDMDLAGLCPMVAGKIPFGFNLPVGKDAAQRIPAIAYNIPDLDATVRVFVNLTSTGES
VACVEADISNGKTVDLVGVKWATAIIAGLALIASAVVNGLGHSNTAAHVAANSLSLFGYFQAQAIVGLTSVHLPP
IVQSWTQDFQWSMGIIRVGFMQDIFTWYQRATGGTPSTIFDSLTTVSVQVAKRSLEYADTGLGLFRRGAAMMPRS
AAVAAVGRLAKRANVTTGSGAYIVYGIQRVAFRSKIETTNLFMTGLTFFCIFVVLTVLSVAAFKGICELFVRQKW
MDKDKFLDFRNGWLTVLKGILFRVALIGFPQMAILCLWEFTQVDSAAEVVLAVFFFFGMALTLAWGATKVIRIAR
RSVAMHRNPAYILFSDPQALNKWGFLYIQFRASAYYFIAPVLGYTLIKAMFVAFAQRSNVAQAVGFVIIEAAALI
AASVLRPWMDKSTNSFNIAICVINFLNAIFLLIFSNVFGAPSLVVGVVGVVLFVLNAAFSLILLIMVIVSTTVTF
FRKNPDARYQVMADDRASFMKSQTQLTTTTELDALAATARGDKAGYKTHLDLDDDNESLASEDLRRRADPNGSQS
SQVSFHPVPGGPRSPVNPSMPLFPAGANQRPQSPFRSPSPNNYSRSGSSLAQTRSHNNASPAAYPPGYHPANGAS
PWQRGAGYD*
Coding >Hirsu2|1257
ATGCGGTCCTTCCTCAAGGCGCCGCTCCTGCTCCTCTCCTCGATGGCGGCGATGCTGTCGCCCGCCTCGGGTGAG
AGGTTGCTCATGTCCAGCTCGCTCAACACGTGCCAGCAGGACTCGAGCTTCACCGCCTCGCTCTTCAACGTCGTC
TACACGCCCAGCAACAACTCGGCCAGCATCAACATGGTGGCCACGTCGTCGGTCCAGGGCAAGGTGCTCTTCGAC
CTGGCCATCTCCGCCTACGGATACCAGTTCCTCCGCATGACGCTCAACCCCTGCGACATGGACCTGGCCGGCCTG
TGCCCCATGGTCGCCGGCAAGATCCCCTTCGGCTTCAACCTGCCCGTCGGCAAGGACGCCGCCCAGCGCATCCCC
GCCATCGCCTACAACATCCCCGACCTCGACGCCACCGTCCGCGTCTTCGTCAACCTGACGTCGACGGGCGAGAGC
GTCGCCTGCGTCGAGGCCGACATCTCCAACGGCAAGACGGTCGACCTCGTCGGCGTCAAGTGGGCCACGGCCATC
ATCGCCGGCCTCGCCCTCATCGCCTCGGCCGTCGTCAACGGCCTCGGCCACTCCAACACGGCCGCCCACGTCGCC
GCCAACTCCCTCTCCCTCTTCGGCTACTTCCAGGCCCAGGCCATCGTCGGCCTGACCAGCGTCCACCTGCCGCCC
ATCGTCCAGTCGTGGACCCAGGACTTCCAGTGGTCCATGGGCATCATCCGCGTCGGCTTCATGCAGGACATCTTC
ACCTGGTACCAGCGCGCCACCGGCGGCACGCCCTCGACCATCTTCGACTCCCTCACCACCGTCTCCGTCCAGGTC
GCCAAGCGCTCGCTCGAGTACGCCGACACGGGCCTCGGCCTCTTCCGCCGCGGCGCCGCCATGATGCCCCGCTCC
GCCGCCGTCGCCGCCGTCGGCCGCCTGGCCAAGCGCGCCAACGTCACGACCGGCTCCGGCGCCTACATCGTCTAC
GGCATCCAGCGCGTCGCCTTCCGCTCCAAGATCGAGACGACCAACCTCTTCATGACGGGCCTCACCTTCTTCTGC
ATCTTCGTCGTCCTCACCGTCCTCTCCGTCGCCGCCTTCAAGGGCATCTGCGAGCTCTTCGTCCGCCAGAAGTGG
ATGGACAAGGACAAGTTCCTCGACTTCCGCAACGGCTGGCTCACCGTCCTCAAGGGCATCCTCTTCCGCGTCGCC
CTCATCGGCTTCCCCCAGATGGCCATCCTCTGCCTCTGGGAGTTCACCCAGGTCGACTCCGCCGCCGAGGTCGTC
CTCGCCGTCTTCTTCTTCTTCGGCATGGCCCTGACGCTCGCCTGGGGCGCCACCAAGGTCATCCGCATCGCCCGC
CGCTCCGTCGCCATGCACCGCAACCCGGCCTACATCCTCTTCTCCGACCCCCAGGCCCTCAACAAGTGGGGCTTC
CTCTACATCCAGTTCCGCGCCTCGGCCTACTACTTCATCGCCCCCGTCCTCGGCTACACGCTCATCAAGGCCATG
TTCGTCGCCTTCGCCCAGCGCAGCAACGTGGCCCAGGCCGTCGGCTTCGTCATCATCGAGGCGGCCGCCCTCATC
GCCGCCTCGGTCCTGCGGCCGTGGATGGACAAGAGCACCAACTCGTTCAACATCGCCATCTGCGTCATCAACTTC
CTCAACGCCATCTTCCTCCTCATCTTCTCCAACGTCTTCGGCGCCCCCAGCCTCGTCGTCGGCGTCGTCGGCGTC
GTCCTCTTTGTCCTCAACGCCGCCTTCTCGCTCATCCTGCTCATCATGGTCATCGTCTCGACCACCGTCACCTTC
TTCCGCAAGAACCCCGACGCCCGCTACCAGGTCATGGCCGACGACCGCGCCTCCTTCATGAAGTCGCAGACGCAG
CTGACGACGACGACGGAGCTCGACGCCCTCGCCGCCACGGCCCGCGGCGACAAGGCCGGCTACAAGACGCACCTC
GACCTCGACGACGACAACGAGTCGCTCGCCTCGGAGGACCTGCGCCGCCGCGCCGACCCCAACGGCTCGCAGTCG
TCGCAGGTCTCCTTCCACCCGGTGCCCGGCGGGCCCCGCTCGCCCGTCAACCCGTCGATGCCCCTCTTCCCGGCC
GGCGCCAACCAGCGGCCCCAGAGCCCGTTCCGGTCGCCGTCGCCCAACAACTACAGCCGCTCCGGCTCGTCGCTC
GCCCAGACGAGGTCGCACAACAACGCGAGCCCCGCCGCCTACCCCCCGGGATACCACCCGGCCAACGGCGCCAGC
CCTTGGCAGAGGGGAGCCGGGTACGATTAA
Transcript >Hirsu2|1257
ATGCGGTCCTTCCTCAAGGCGCCGCTCCTGCTCCTCTCCTCGATGGCGGCGATGCTGTCGCCCGCCTCGGGTGAG
AGGTTGCTCATGTCCAGCTCGCTCAACACGTGCCAGCAGGACTCGAGCTTCACCGCCTCGCTCTTCAACGTCGTC
TACACGCCCAGCAACAACTCGGCCAGCATCAACATGGTGGCCACGTCGTCGGTCCAGGGCAAGGTGCTCTTCGAC
CTGGCCATCTCCGCCTACGGATACCAGTTCCTCCGCATGACGCTCAACCCCTGCGACATGGACCTGGCCGGCCTG
TGCCCCATGGTCGCCGGCAAGATCCCCTTCGGCTTCAACCTGCCCGTCGGCAAGGACGCCGCCCAGCGCATCCCC
GCCATCGCCTACAACATCCCCGACCTCGACGCCACCGTCCGCGTCTTCGTCAACCTGACGTCGACGGGCGAGAGC
GTCGCCTGCGTCGAGGCCGACATCTCCAACGGCAAGACGGTCGACCTCGTCGGCGTCAAGTGGGCCACGGCCATC
ATCGCCGGCCTCGCCCTCATCGCCTCGGCCGTCGTCAACGGCCTCGGCCACTCCAACACGGCCGCCCACGTCGCC
GCCAACTCCCTCTCCCTCTTCGGCTACTTCCAGGCCCAGGCCATCGTCGGCCTGACCAGCGTCCACCTGCCGCCC
ATCGTCCAGTCGTGGACCCAGGACTTCCAGTGGTCCATGGGCATCATCCGCGTCGGCTTCATGCAGGACATCTTC
ACCTGGTACCAGCGCGCCACCGGCGGCACGCCCTCGACCATCTTCGACTCCCTCACCACCGTCTCCGTCCAGGTC
GCCAAGCGCTCGCTCGAGTACGCCGACACGGGCCTCGGCCTCTTCCGCCGCGGCGCCGCCATGATGCCCCGCTCC
GCCGCCGTCGCCGCCGTCGGCCGCCTGGCCAAGCGCGCCAACGTCACGACCGGCTCCGGCGCCTACATCGTCTAC
GGCATCCAGCGCGTCGCCTTCCGCTCCAAGATCGAGACGACCAACCTCTTCATGACGGGCCTCACCTTCTTCTGC
ATCTTCGTCGTCCTCACCGTCCTCTCCGTCGCCGCCTTCAAGGGCATCTGCGAGCTCTTCGTCCGCCAGAAGTGG
ATGGACAAGGACAAGTTCCTCGACTTCCGCAACGGCTGGCTCACCGTCCTCAAGGGCATCCTCTTCCGCGTCGCC
CTCATCGGCTTCCCCCAGATGGCCATCCTCTGCCTCTGGGAGTTCACCCAGGTCGACTCCGCCGCCGAGGTCGTC
CTCGCCGTCTTCTTCTTCTTCGGCATGGCCCTGACGCTCGCCTGGGGCGCCACCAAGGTCATCCGCATCGCCCGC
CGCTCCGTCGCCATGCACCGCAACCCGGCCTACATCCTCTTCTCCGACCCCCAGGCCCTCAACAAGTGGGGCTTC
CTCTACATCCAGTTCCGCGCCTCGGCCTACTACTTCATCGCCCCCGTCCTCGGCTACACGCTCATCAAGGCCATG
TTCGTCGCCTTCGCCCAGCGCAGCAACGTGGCCCAGGCCGTCGGCTTCGTCATCATCGAGGCGGCCGCCCTCATC
GCCGCCTCGGTCCTGCGGCCGTGGATGGACAAGAGCACCAACTCGTTCAACATCGCCATCTGCGTCATCAACTTC
CTCAACGCCATCTTCCTCCTCATCTTCTCCAACGTCTTCGGCGCCCCCAGCCTCGTCGTCGGCGTCGTCGGCGTC
GTCCTCTTTGTCCTCAACGCCGCCTTCTCGCTCATCCTGCTCATCATGGTCATCGTCTCGACCACCGTCACCTTC
TTCCGCAAGAACCCCGACGCCCGCTACCAGGTCATGGCCGACGACCGCGCCTCCTTCATGAAGTCGCAGACGCAG
CTGACGACGACGACGGAGCTCGACGCCCTCGCCGCCACGGCCCGCGGCGACAAGGCCGGCTACAAGACGCACCTC
GACCTCGACGACGACAACGAGTCGCTCGCCTCGGAGGACCTGCGCCGCCGCGCCGACCCCAACGGCTCGCAGTCG
TCGCAGGTCTCCTTCCACCCGGTGCCCGGCGGGCCCCGCTCGCCCGTCAACCCGTCGATGCCCCTCTTCCCGGCC
GGCGCCAACCAGCGGCCCCAGAGCCCGTTCCGGTCGCCGTCGCCCAACAACTACAGCCGCTCCGGCTCGTCGCTC
GCCCAGACGAGGTCGCACAACAACGCGAGCCCCGCCGCCTACCCCCCGGGATACCACCCGGCCAACGGCGCCAGC
CCTTGGCAGAGGGGAGCCGGGTACGATTAA
Gene >Hirsu2|1257
ATGCGGTCCTTCCTCAAGGCGCCGCTCCTGCTCCTCTCCTCGATGGCGGCGATGCTGTCGCCCGCCTCGGGTGAG
AGGTTGCTCATGTCCAGCTCGCTCAACACGTGCCAGCAGGACTCGAGCTTCACCGCCTCGCTCTTCAACGTCGTC
TACACGCCCAGCAACAACTCGGCCAGCATCAACATGGTGGCCACGTCGTCGGTCCAGGGCAAGGTGCTCTTCGAC
CTGGCCATCTCCGCCTACGGATACCAGTTCCTCCGCATGACGCTCAACCCCTGCGACATGGACCTGGCCGGCCTG
TGCCCCATGGTCGCCGGCAAGATCCCCTTCGGCTTCAACCTGCCCGTCGGCAAGGACGCCGCCCAGCGCATCCCC
GCCATCGCCTACAACATCCCCGACCTCGACGCCACCGTCCGCGTCTTCGTCAACCTGACGTCGACGGGCGAGAGC
GTCGCCTGCGTCGAGGCCGACATCTCCAACGGCAAGACGGTCGACCTCGTCGGCGTCAAGTGGGCCACGGCCATC
ATCGCCGGCCTCGCCCTCATCGCCTCGGCCGTCGTCAACGGCCTCGGCCACTCCAACACGGCCGCCCACGTCGCC
GCCAACTCCCTCTCCCTCTTCGGCTACTTCCAGGCCCAGGCCATCGTCGGCCTGACCAGCGTCCACCTGCCGCCC
ATCGTCCAGTCGTGGACCCAGGACTTCCAGTGGTCCATGGGCATCATCCGCGTCGGCTTCATGCAGGACATCTTC
ACCTGGTACCAGCGCGCCACCGGCGGCACGCCCTCGACCATCTTCGACTCCCTCACCACCGTCTCCGTCCAGGTC
GCCAAGCGCTCGCTCGAGTACGCCGACACGGGCCTCGGCCTCTTCCGCCGCGGCGCCGCCATGATGCCCCGCTCC
GCCGCCGTCGCCGCCGTCGGCCGCCTGGCCAAGCGCGCCAACGTCACGACCGGCTCCGGCGCCTACATCGTCTAC
GGCATCCAGCGCGTCGCCTTCCGCTCCAAGATCGAGACGACCAACCTCTTCATGACGGGCCTCACCTTCTTCTGC
ATCTTCGTCGTCCTCACCGTCCTCTCCGTCGCCGCCTTCAAGGGCATCTGCGAGCTCTTCGTCCGCCAGAAGTGG
ATGGACAAGGACAAGTTCCTCGACTTCCGCAACGGCTGGCTCACCGTCCTCAAGGGCATCCTCTTCCGCGTCGCC
CTCATCGGCTTCCCCCAGATGGCCATCCTCTGCCTCTGGGAGTTCACCCAGGTCGACTCCGCCGCCGAGGTCGTC
CTCGCCGTCTTCTTCTTCTTCGGCATGGCCCTGACGCTCGCCTGGGGCGCCACCAAGGTCATCCGCATCGCCCGC
CGCTCCGTCGCCATGCACCGCAACCCGGCCTACATCCTCTTCTCCGACCCCCAGGCCCTCAACAAGTGGGGCTTC
CTCTACATCCAGTTCCGCGCCTCGGCCTACTACTTCATCGCCCCCGTCCTCGGCTACACGCTCATCAAGGCCATG
TTCGTCGCCTTCGCCCAGCGCAGCAACGTGGCCCAGGCCGTCGGCTTCGTCATCATCGAGGCGGCCGCCCTCATC
GCCGCCTCGGTCCTGCGGCCGTGGATGGACAAGAGCACCAACTCGTTCAACATCGCCATCTGCGTCATCAACTTC
CTCAACGCCATCTTCCTCCTCATCTTCTCCAACGTCTTCGGCGCCCCCAGCCTCGTCGTCGGCGTCGTCGGCGTC
GTCCTCTTTGTCCTCAACGCCGCCTTCTCGCTCATCCTGCTCATCATGGTCATCGTCTCGACCACCGTCACCTTC
TTCCGCAAGAACCCCGACGCCCGCTACCAGGTCATGGCCGACGACCGCGCCTCCTTCATGAAGTCGCAGACGCAG
CTGACGACGACGACGGAGCTCGACGCCCTCGCCGCCACGGCCCGCGGCGACAAGGCCGGCTACAAGACGCACCTC
GACCTCGACGACGACAACGAGTCGCTCGCCTCGGAGGACCTGCGCCGCCGCGCCGACCCCAACGGCTCGCAGTCG
TCGCAGGTCTCCTTCCACCCGGTGCCCGGCGGGCCCCGCTCGCCCGTCAACCCGTCGATGCCCCTCTTCCCGGCC
GGCGCCAACCAGCGGCCCCAGAGCCCGTTCCGGTCGCCGTCGCCCAACAACTACAGCCGCTCCGGCTCGTCGCTC
GCCCAGACGAGGTCGCACAACAACGCGAGCCCCGCCGCCTACCCCCCGGGATACCACCCGGCCAACGGCGCCAGG
TAAGTTTGCCGTCCCTCACCCCTCTCGGCTCACCGAGGGGCACGCGCGGCTGACGGAGCTCCGACAGCCCTTGGC
AGAGGGGAGCCGGGTACGATTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail