Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1252
Gene name
LocationContig_1272:4587..7043
Strand-
Gene length (bp)2456
Transcript length (bp)2256
Coding sequence length (bp)2256
Protein length (aa) 752

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 1.5E-09 330 577

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens GN=HSPA12A PE=1 SV=2 187 698 3.0E-26
sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus GN=Hspa12a PE=1 SV=1 187 698 5.0E-26
sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapiens GN=HSPA12B PE=1 SV=2 176 705 2.0E-25
sp|Q48M01|HSCA_PSE14 Chaperone protein HscA homolog OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hscA PE=3 SV=1 186 546 3.0E-08
sp|Q4ZX30|HSCA_PSEU2 Chaperone protein HscA homolog OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hscA PE=3 SV=1 186 546 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens GN=HSPA12A PE=1 SV=2 187 698 3.0E-26
sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus GN=Hspa12a PE=1 SV=1 187 698 5.0E-26
sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapiens GN=HSPA12B PE=1 SV=2 176 705 2.0E-25
sp|Q48M01|HSCA_PSE14 Chaperone protein HscA homolog OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hscA PE=3 SV=1 186 546 3.0E-08
sp|Q4ZX30|HSCA_PSEU2 Chaperone protein HscA homolog OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hscA PE=3 SV=1 186 546 6.0E-08
sp|B2GGP0|DNAK_KOCRD Chaperone protein DnaK OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=dnaK PE=3 SV=1 189 426 7.0E-08
sp|P64409|DNAK_TROWT Chaperone protein DnaK OS=Tropheryma whipplei (strain Twist) GN=dnaK PE=3 SV=1 314 426 9.0E-08
sp|P64410|DNAK_TROW8 Chaperone protein DnaK OS=Tropheryma whipplei (strain TW08/27) GN=dnaK PE=3 SV=1 314 426 9.0E-08
sp|A6WFV7|DNAK_KINRD Chaperone protein DnaK OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=dnaK PE=3 SV=1 189 426 1.0E-07
sp|Q01233|HSP70_NEUCR Heat shock 70 kDa protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsps-1 PE=2 SV=2 189 589 1.0E-07
sp|Q6AC76|DNAK_LEIXX Chaperone protein DnaK OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=dnaK PE=3 SV=1 314 426 2.0E-07
sp|B8D758|DNAK_BUCAT Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaK PE=3 SV=1 188 446 5.0E-07
sp|O32464|DNAK_BUCAI Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaK PE=3 SV=1 188 446 5.0E-07
sp|B8D8V4|DNAK_BUCA5 Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaK PE=3 SV=1 188 446 5.0E-07
sp|Q886Z7|HSCA_PSESM Chaperone protein HscA homolog OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hscA PE=3 SV=1 186 546 7.0E-07
sp|P41826|HSP72_ANOAL Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1 332 463 8.0E-07
sp|P41825|HSP71_ANOAL Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1 332 463 8.0E-07
sp|P40918|HSP70_DAVTA Heat shock 70 kDa protein OS=Davidiella tassiana GN=HSP70 PE=1 SV=1 296 463 9.0E-07
sp|P36604|GRP78_SCHPO 78 kDa glucose-regulated protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bip1 PE=3 SV=2 188 546 9.0E-07
sp|A5CM86|DNAK_CLAM3 Chaperone protein DnaK OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=dnaK PE=3 SV=1 332 426 1.0E-06
sp|B0RBI1|DNAK_CLAMS Chaperone protein DnaK OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=dnaK PE=3 SV=1 332 426 1.0E-06
sp|A9WQR3|DNAK_RENSM Chaperone protein DnaK OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=dnaK PE=3 SV=1 296 426 1.0E-06
sp|B8H6Q1|DNAK_ARTCA Chaperone protein DnaK OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=dnaK PE=3 SV=1 296 426 1.0E-06
sp|Q05931|HSP7Q_YEAST Heat shock protein SSQ1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSQ1 PE=1 SV=1 188 426 1.0E-06
sp|A6LM32|DNAK_THEM4 Chaperone protein DnaK OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaK PE=3 SV=1 183 408 1.0E-06
sp|A0K1L3|DNAK_ARTS2 Chaperone protein DnaK OS=Arthrobacter sp. (strain FB24) GN=dnaK PE=3 SV=1 296 454 1.0E-06
sp|B7ID00|DNAK_THEAB Chaperone protein DnaK OS=Thermosipho africanus (strain TCF52B) GN=dnaK PE=3 SV=1 183 446 2.0E-06
sp|Q9VG58|HSP74_DROME Major heat shock 70 kDa protein Bbb OS=Drosophila melanogaster GN=Hsp70Bbb PE=3 SV=2 332 448 2.0E-06
sp|Q97BG8|DNAK_THEVO Chaperone protein DnaK OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaK PE=3 SV=1 305 593 2.0E-06
sp|P41827|HSP74_ANOAL Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1 332 463 2.0E-06
sp|C5C3P2|DNAK_BEUC1 Chaperone protein DnaK OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=dnaK PE=3 SV=1 332 458 2.0E-06
sp|P91902|HSP70_CERCA Heat shock protein 70 OS=Ceratitis capitata PE=2 SV=1 189 478 2.0E-06
sp|Q9BIS2|HSP73_DROME Major heat shock 70 kDa protein Bb OS=Drosophila melanogaster GN=Hsp70Bb PE=2 SV=2 332 448 3.0E-06
sp|A4T112|DNAK_MYCGI Chaperone protein DnaK OS=Mycobacterium gilvum (strain PYR-GCK) GN=dnaK PE=3 SV=1 189 426 3.0E-06
sp|P75344|DNAK_MYCPN Chaperone protein DnaK OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaK PE=3 SV=1 187 587 3.0E-06
sp|Q00043|HSP70_AJECA Heat shock 70 kDa protein OS=Ajellomyces capsulatus GN=HSP70 PE=3 SV=1 189 597 3.0E-06
sp|Q9GSU4|HSP72_DROSI Major heat shock 70 kDa protein Ba OS=Drosophila simulans GN=Hsp70Ba PE=3 SV=2 332 448 3.0E-06
sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 296 587 3.0E-06
sp|Q8INI8|HSP72_DROME Major heat shock 70 kDa protein Ba OS=Drosophila melanogaster GN=Hsp70Ba PE=2 SV=2 332 448 3.0E-06
sp|Q9BIR7|HSP75_DROME Major heat shock 70 kDa protein Bc OS=Drosophila melanogaster GN=Hsp70Bc PE=2 SV=2 332 448 3.0E-06
sp|Q9GSU7|HSP71_DROSI Major heat shock 70 kDa protein Ab OS=Drosophila simulans GN=Hsp70Ab PE=3 SV=2 332 448 3.0E-06
sp|B8DT62|DNAK_BIFA0 Chaperone protein DnaK OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=dnaK PE=3 SV=1 314 426 4.0E-06
sp|Q3K7A9|HSCA_PSEPF Chaperone protein HscA homolog OS=Pseudomonas fluorescens (strain Pf0-1) GN=hscA PE=3 SV=1 186 403 4.0E-06
sp|Q1IWL4|DNAK_DEIGD Chaperone protein DnaK OS=Deinococcus geothermalis (strain DSM 11300) GN=dnaK PE=3 SV=1 189 446 4.0E-06
sp|B2URT8|DNAK_HELPS Chaperone protein DnaK OS=Helicobacter pylori (strain Shi470) GN=dnaK PE=3 SV=1 188 426 5.0E-06
sp|A9A135|DNAK_NITMS Chaperone protein DnaK OS=Nitrosopumilus maritimus (strain SCM1) GN=dnaK PE=3 SV=1 297 627 5.0E-06
sp|Q3JQN9|HSCA_BURP1 Chaperone protein HscA homolog OS=Burkholderia pseudomallei (strain 1710b) GN=hscA PE=3 SV=1 186 546 5.0E-06
sp|Q96W30|HSP72_PARBA Heat shock 70 kDa protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2 189 598 5.0E-06
sp|P11146|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2 332 448 5.0E-06
sp|O97125|HSP68_DROME Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1 332 446 5.0E-06
sp|P47547|DNAK_MYCGE Chaperone protein DnaK OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaK PE=3 SV=1 187 587 5.0E-06
sp|Q9ZMW4|DNAK_HELPJ Chaperone protein DnaK OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dnaK PE=3 SV=3 188 426 5.0E-06
sp|Q63SN5|HSCA_BURPS Chaperone protein HscA homolog OS=Burkholderia pseudomallei (strain K96243) GN=hscA PE=3 SV=1 186 546 6.0E-06
sp|A3NX33|HSCA_BURP0 Chaperone protein HscA homolog OS=Burkholderia pseudomallei (strain 1106a) GN=hscA PE=3 SV=1 186 546 6.0E-06
sp|A3NBA0|HSCA_BURP6 Chaperone protein HscA homolog OS=Burkholderia pseudomallei (strain 668) GN=hscA PE=3 SV=1 186 546 6.0E-06
sp|Q1BEV1|DNAK_MYCSS Chaperone protein DnaK OS=Mycobacterium sp. (strain MCS) GN=dnaK PE=3 SV=1 189 426 7.0E-06
sp|A1UA31|DNAK_MYCSK Chaperone protein DnaK OS=Mycobacterium sp. (strain KMS) GN=dnaK PE=3 SV=1 189 426 7.0E-06
sp|A3PTN4|DNAK_MYCSJ Chaperone protein DnaK OS=Mycobacterium sp. (strain JLS) GN=dnaK PE=3 SV=1 189 426 7.0E-06
sp|A9AGU7|HSCA_BURM1 Chaperone protein HscA homolog OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hscA PE=3 SV=1 186 546 7.0E-06
sp|Q7UM31|DNAK_RHOBA Chaperone protein DnaK OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=dnaK PE=3 SV=2 183 463 7.0E-06
sp|Q4K6U2|HSCA_PSEF5 Chaperone protein HscA homolog OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hscA PE=3 SV=1 186 403 8.0E-06
sp|Q17VY4|DNAK_HELAH Chaperone protein DnaK OS=Helicobacter acinonychis (strain Sheeba) GN=dnaK PE=3 SV=1 188 426 8.0E-06
sp|Q6D0B7|DNAK_PECAS Chaperone protein DnaK OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dnaK PE=3 SV=1 188 446 8.0E-06
sp|A5UAB3|HSCA_HAEIE Chaperone protein HscA homolog OS=Haemophilus influenzae (strain PittEE) GN=hscA PE=3 SV=1 178 557 9.0E-06
sp|Q95YL7|HSP70_ENCHE Mitochondrial-type heat shock protein 70 OS=Encephalitozoon hellem GN=HSP70 PE=3 SV=1 181 598 9.0E-06
sp|Q2SXE0|HSCA_BURTA Chaperone protein HscA homolog OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=hscA PE=3 SV=1 186 546 9.0E-06
sp|Q72IK5|DNAK_THET2 Chaperone protein DnaK OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaK PE=3 SV=1 189 446 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1252
MNSMNSRLKFGFGKRKSAASIQTGVEGVPPTSTPPPGQIPPHQASHPGHTPPLGAAASSSTSLPMNHPPPGNRPP
SYSANYPPGAPLDRASPHQGHSRTPPSQMAGGPPPINTGAPVGYPPPNMPGMGQGPPPMGPLPPGGPPGFGGQTG
YPPAGPPPPPGGPIAQAFQRANSAAEVEGASKSKAQLIVGIDFGTTFSGVAFAFATNNEAKEDIISEWPGAGSYT
KQKIPTVLYYDQYQKVVGWGPDIADALAPTGYPKPGVQKVEWFKLQLMLSGNTYIDPINLPPLPPGKSEIDVAAD
YLFKLRQAMRSALQKTLGEVFNREERNIRYYLTVPAIWNDAGKAATRAAAIQAGFLRDENDNRLTLISEPEAAAL
FCSKTGLLNLKVHDAVLIVDCGGGTVDLIAYEVEEENPFTVAECTAGSGDSCGSTALNRNFSNILRTKIRKMKLP
DGSKTAGRVYAKCIMDFENRIKADFRNNGQKWAVDVGIEAEFPEAGIEEGYMTFTNEEILQCFEPVVNRILELVR
NQIIAIQAQNRTLQNILVVGGFGASEYLFQQIKLHVPPQFQSKVVRPMDSVAAIVKGAVTAGITERIITHRVARR
HYLMATLQPFKEGYHPEAYRVPSLDGKDRCKFTRQIFVQKGQKVKNGEPVKVSFFRQVAPGATLMYEDVLYACDD
DVCPEYTKDPRIKEVVTLTSDLSRKNLEKDFERMDTPQGTFYRVYFDIYLTLDGSEFSAELVCQGEVMGRCRARF
R*
Coding >Hirsu2|1252
ATGAACTCTATGAACTCCCGCCTCAAGTTCGGGTTCGGGAAACGCAAATCAGCCGCCAGCATTCAGACGGGTGTC
GAGGGGGTCCCTCCCACCAGCACCCCTCCGCCGGGCCAAATACCTCCGCACCAGGCCTCGCACCCGGGCCACACG
CCTCCCCTCGGCGCCGCCGCCTCGTCGTCCACCAGCCTCCCGATGAACCACCCGCCGCCGGGCAATCGTCCGCCC
AGCTACTCGGCCAACTATCCGCCCGGCGCGCCCCTCGACCGGGCCAGCCCTCACCAGGGCCACAGCCGCACCCCG
CCCAGCCAGATGGCCGGCGGCCCGCCTCCCATCAACACCGGCGCCCCCGTCGGCTATCCGCCGCCCAATATGCCC
GGCATGGGCCAAGGTCCGCCGCCCATGGGTCCTCTGCCCCCCGGGGGGCCTCCCGGCTTTGGTGGACAGACGGGC
TACCCCCCCGCCGGCCCGCCGCCCCCGCCAGGTGGTCCCATTGCGCAAGCCTTCCAGCGTGCAAACTCGGCGGCC
GAGGTTGAGGGCGCCAGCAAGAGCAAGGCCCAGTTGATTGTCGGCATAGATTTTGGCACCACCTTCTCCGGTGTC
GCCTTCGCCTTCGCGACCAACAACGAGGCCAAGGAGGACATCATCAGCGAATGGCCCGGCGCCGGCTCCTACACC
AAGCAAAAGATCCCGACGGTCCTATACTACGACCAATATCAGAAAGTGGTGGGCTGGGGGCCCGATATCGCCGAC
GCCCTGGCCCCGACCGGCTACCCCAAACCCGGCGTGCAAAAGGTGGAGTGGTTCAAGCTGCAGCTCATGCTCAGC
GGCAACACGTACATCGATCCCATCAACCTGCCTCCCCTGCCGCCGGGCAAGTCCGAGATCGACGTGGCCGCAGAC
TACCTCTTCAAGCTCCGCCAAGCGATGCGGTCGGCCCTGCAGAAGACGTTGGGAGAGGTGTTCAACCGAGAGGAG
CGCAACATCCGATACTACCTGACCGTGCCGGCCATCTGGAACGACGCCGGCAAGGCGGCTACCCGGGCCGCGGCC
ATCCAGGCGGGATTCCTTCGCGACGAGAACGACAACCGGCTGACCCTGATCTCGGAGCCCGAGGCCGCCGCCCTG
TTCTGCTCCAAGACGGGGCTGCTGAACCTCAAGGTGCACGATGCGGTGCTGATTGTCGACTGCGGCGGCGGCACC
GTGGACTTGATCGCGTACGAGGTCGAGGAGGAGAATCCCTTCACCGTCGCCGAGTGCACGGCGGGGTCGGGAGAC
TCGTGCGGCTCGACGGCGCTGAACCGCAACTTCAGCAACATCCTGCGGACCAAGATTCGCAAGATGAAGCTGCCC
GACGGATCCAAGACGGCCGGGCGCGTCTACGCCAAGTGCATCATGGATTTCGAGAACCGGATCAAGGCCGACTTC
CGCAACAACGGGCAGAAGTGGGCCGTCGACGTCGGCATCGAGGCCGAGTTCCCCGAGGCCGGCATCGAGGAAGGC
TACATGACCTTTACCAACGAGGAGATCCTGCAGTGCTTCGAGCCCGTCGTCAATCGGATCCTCGAGCTGGTCCGG
AACCAGATCATCGCCATCCAGGCGCAGAACCGGACACTGCAAAACATACTGGTCGTCGGCGGCTTTGGCGCGTCA
GAGTACCTCTTCCAGCAAATCAAGCTGCACGTGCCGCCCCAGTTCCAGTCCAAAGTGGTGCGCCCGATGGACTCG
GTCGCCGCCATCGTCAAGGGGGCCGTCACGGCCGGCATCACGGAGCGCATCATCACGCACCGAGTTGCCCGGCGA
CACTACCTCATGGCCACGCTGCAGCCGTTCAAGGAGGGCTACCATCCCGAGGCCTACCGCGTGCCCTCTCTCGAC
GGCAAGGATCGATGCAAGTTCACGAGGCAAATCTTCGTGCAGAAGGGCCAGAAGGTCAAGAACGGCGAACCGGTC
AAGGTGTCGTTCTTCCGCCAAGTCGCACCCGGCGCGACGCTCATGTACGAAGATGTGCTGTACGCCTGCGACGAC
GATGTCTGCCCCGAGTATACCAAGGATCCGCGCATCAAGGAGGTCGTGACGCTCACCTCGGACCTGTCGCGCAAA
AATCTGGAAAAGGACTTTGAGAGGATGGACACGCCTCAGGGAACATTCTATCGCGTCTACTTCGACATCTATCTC
ACGCTCGACGGCTCAGAGTTCAGTGCCGAGCTGGTGTGCCAGGGCGAGGTCATGGGCCGCTGCCGCGCACGCTTC
CGGTGA
Transcript >Hirsu2|1252
ATGAACTCTATGAACTCCCGCCTCAAGTTCGGGTTCGGGAAACGCAAATCAGCCGCCAGCATTCAGACGGGTGTC
GAGGGGGTCCCTCCCACCAGCACCCCTCCGCCGGGCCAAATACCTCCGCACCAGGCCTCGCACCCGGGCCACACG
CCTCCCCTCGGCGCCGCCGCCTCGTCGTCCACCAGCCTCCCGATGAACCACCCGCCGCCGGGCAATCGTCCGCCC
AGCTACTCGGCCAACTATCCGCCCGGCGCGCCCCTCGACCGGGCCAGCCCTCACCAGGGCCACAGCCGCACCCCG
CCCAGCCAGATGGCCGGCGGCCCGCCTCCCATCAACACCGGCGCCCCCGTCGGCTATCCGCCGCCCAATATGCCC
GGCATGGGCCAAGGTCCGCCGCCCATGGGTCCTCTGCCCCCCGGGGGGCCTCCCGGCTTTGGTGGACAGACGGGC
TACCCCCCCGCCGGCCCGCCGCCCCCGCCAGGTGGTCCCATTGCGCAAGCCTTCCAGCGTGCAAACTCGGCGGCC
GAGGTTGAGGGCGCCAGCAAGAGCAAGGCCCAGTTGATTGTCGGCATAGATTTTGGCACCACCTTCTCCGGTGTC
GCCTTCGCCTTCGCGACCAACAACGAGGCCAAGGAGGACATCATCAGCGAATGGCCCGGCGCCGGCTCCTACACC
AAGCAAAAGATCCCGACGGTCCTATACTACGACCAATATCAGAAAGTGGTGGGCTGGGGGCCCGATATCGCCGAC
GCCCTGGCCCCGACCGGCTACCCCAAACCCGGCGTGCAAAAGGTGGAGTGGTTCAAGCTGCAGCTCATGCTCAGC
GGCAACACGTACATCGATCCCATCAACCTGCCTCCCCTGCCGCCGGGCAAGTCCGAGATCGACGTGGCCGCAGAC
TACCTCTTCAAGCTCCGCCAAGCGATGCGGTCGGCCCTGCAGAAGACGTTGGGAGAGGTGTTCAACCGAGAGGAG
CGCAACATCCGATACTACCTGACCGTGCCGGCCATCTGGAACGACGCCGGCAAGGCGGCTACCCGGGCCGCGGCC
ATCCAGGCGGGATTCCTTCGCGACGAGAACGACAACCGGCTGACCCTGATCTCGGAGCCCGAGGCCGCCGCCCTG
TTCTGCTCCAAGACGGGGCTGCTGAACCTCAAGGTGCACGATGCGGTGCTGATTGTCGACTGCGGCGGCGGCACC
GTGGACTTGATCGCGTACGAGGTCGAGGAGGAGAATCCCTTCACCGTCGCCGAGTGCACGGCGGGGTCGGGAGAC
TCGTGCGGCTCGACGGCGCTGAACCGCAACTTCAGCAACATCCTGCGGACCAAGATTCGCAAGATGAAGCTGCCC
GACGGATCCAAGACGGCCGGGCGCGTCTACGCCAAGTGCATCATGGATTTCGAGAACCGGATCAAGGCCGACTTC
CGCAACAACGGGCAGAAGTGGGCCGTCGACGTCGGCATCGAGGCCGAGTTCCCCGAGGCCGGCATCGAGGAAGGC
TACATGACCTTTACCAACGAGGAGATCCTGCAGTGCTTCGAGCCCGTCGTCAATCGGATCCTCGAGCTGGTCCGG
AACCAGATCATCGCCATCCAGGCGCAGAACCGGACACTGCAAAACATACTGGTCGTCGGCGGCTTTGGCGCGTCA
GAGTACCTCTTCCAGCAAATCAAGCTGCACGTGCCGCCCCAGTTCCAGTCCAAAGTGGTGCGCCCGATGGACTCG
GTCGCCGCCATCGTCAAGGGGGCCGTCACGGCCGGCATCACGGAGCGCATCATCACGCACCGAGTTGCCCGGCGA
CACTACCTCATGGCCACGCTGCAGCCGTTCAAGGAGGGCTACCATCCCGAGGCCTACCGCGTGCCCTCTCTCGAC
GGCAAGGATCGATGCAAGTTCACGAGGCAAATCTTCGTGCAGAAGGGCCAGAAGGTCAAGAACGGCGAACCGGTC
AAGGTGTCGTTCTTCCGCCAAGTCGCACCCGGCGCGACGCTCATGTACGAAGATGTGCTGTACGCCTGCGACGAC
GATGTCTGCCCCGAGTATACCAAGGATCCGCGCATCAAGGAGGTCGTGACGCTCACCTCGGACCTGTCGCGCAAA
AATCTGGAAAAGGACTTTGAGAGGATGGACACGCCTCAGGGAACATTCTATCGCGTCTACTTCGACATCTATCTC
ACGCTCGACGGCTCAGAGTTCAGTGCCGAGCTGGTGTGCCAGGGCGAGGTCATGGGCCGCTGCCGCGCACGCTTC
CGGTGA
Gene >Hirsu2|1252
ATGAACTCTATGAACTCCCGCCTCAAGTTCGGGTTCGGGAAACGCAAATCAGCCGCCAGCATTCAGACGGGTGTC
GAGGGGGTCCCTCCCACCAGCACCCCTCCGCCGGGCCAAATACCTCCGCACCAGGCCTCGCACCCGGGCCACACG
CCTCCCCTCGGCGCCGCCGCCTCGTCGTCCACCAGCCTCCCGATGAACCACCCGCCGCCGGGCAATCGTCCGCCC
AGCTACTCGGCCAACTATCCGCCCGGCGCGCCCCTCGACCGGGCCAGCCCTCACCAGGGCCACAGCCGCACCCCG
CCCAGCCAGATGGCCGGCGGCCCGCCTCCCATCAACACCGGCGCCCCCGTCGGCTATCCGCCGCCCAATATGCCC
GGCATGGGCCAAGGTCCGCCGCCCATGGGTCCTCTGCCCCCCGGGGGGCCTCCCGGCTTTGGTGGACAGACGGGC
TACCCCCCCGCCGGCCCGCCGCCCCCGCCAGGTGGTCCCATTGCGCAAGCCTTCCAGCGTGCAAACTCGGCGGCC
GAGGTTGAGGGCGCCAGCAAGAGCAAGGCCCAGTTGATTGTCGGCATAGATTTTGTCAGAGCAACCGCGTCCCCT
CGCCCCGGCTAATTGCCGGTGACTAACGTGTCCATGTGTAGGGCACCACCTTCTCCGGTGTCGCCTTCGCCTTCG
CGACCAACAACGAGGCCAAGGAGGACATCATCAGCGAATGGCCCGGCGCCGGCTCCTACACCAAGCAAAAGGTCG
GTAGAGGCTACATGGGAGGGCTCGGCCGTGTCGTCGATCCGCTGCTGACGGGGCTTGTCGTAGATCCCGACGGTC
CTATACTACGACCAATATCAGAAAGTGGTGGGCTGGGGGCCCGATATCGCCGACGCCCTGGCCCCGACCGGCTAC
CCCAAACCCGGCGTGCAAAAGGTGGAGTGGTTCAAGCTGCAGCTCATGCTCAGCGGCAACACGTACATCGATCCC
ATCAACCTGCCTCCCCTGCCGCCGGGCAAGTCCGAGATCGACGTGGCCGCAGACTACCTCTTCAAGCTCCGCCAA
GCGATGCGGTCGGCCCTGCAGAAGACGTTGGGAGAGGTGTTCAACCGAGAGGAGCGCAACATCCGATACTACCTG
ACCGTGCCGGCCATCTGGAACGACGCCGGCAAGGCGGCTACCCGGGCCGCGGCCATCCAGGCGGGATTCCTTCGC
GACGAGAACGACAACCGGCTGACCCTGATCTCGGAGCCCGAGGCCGCCGCCCTGTTCTGCTCCAAGACGGGGCTG
CTGAACCTCAAGGTGCACGATGCGGTGCTGATTGTCGACTGCGGCGGCGGCACCGTGGACTTGATCGCGTACGAG
GTCGAGGAGGAGAATCCCTTCACCGTCGCCGAGTGCACGGCGGGGTCGGGAGACTCGTGCGGCTCGACGGCGCTG
AACCGCAACTTCAGCAACATCCTGCGGACCAAGATTCGCAAGATGAAGCTGCCCGACGGATCCAAGACGGCCGGG
CGCGTCTACGCCAAGTGCATCATGGATTTCGAGAACCGGATCAAGGCCGACTTCCGCAACAACGGGCAGAAGTGG
GCCGTCGACGTCGGCATCGAGGCCGAGTTCCCCGAGGCCGGCATCGAGGAAGGCTACATGACCTTTACCAACGAG
GAGATCCTGCAGTGCTTCGAGCCCGTCGTCAATCGGATCCTCGAGCTGGTCCGGAACCAGATCATCGCCATCCAG
GCGCAGAACCGGACACTGCAAAACATACTGGTCGTCGGCGGCTTTGGCGCGTCAGAGTACCTCTTCCAGCAAATC
AAGCTGCACGTGCCGCCCCAGTTCCAGTCCAAAGTGGTGCGCCCGATGGACTCGGTCGCCGCCATCGTCAAGGGG
GCCGTCACGGCCGGCATCACGGAGCGCATCATCACGCACCGAGTTGCCCGGCGACACTACCTCATGGCCACGCTG
CAGCCGTTCAAGGAGGGCTACCATCCCGAGGCCTACCGCGTGCCCTCTCTCGACGGCAAGGATCGATGCAAGTTC
ACGAGGCAAATCTTCGTGCAGAAGGGCCAGAAGGTCAAGAACGGCGAACCGGTCAAGGTGTCGTTCTTCCGCCAA
GTCGCACCCGGCGCGACGCTCATGTACGAAGATGTGCTGTACGCCTGCGACGACGATGTCTGCCCCGAGTATACC
AAGGATCCGCGTAAGTCTCGGAACCCGTTGGTGGTCCTGCCGAGAGAACATGTCACGCTGACGGTGGACTCAATG
TCACAGGCATCAAGGAGGTCGTGACGCTCACCTCGGACCTGTCGCGCAAAAATCTGGAAAAGGACTTTGAGAGGA
TGGACACGCCTCAGGGAACATTCTATCGCGTCTACTTCGACATCTATCTCACGCTCGACGGCTCAGAGTTCAGTG
CCGAGCTGGTGTGCCAGGGCGAGGTCATGGGCCGCTGCCGCGCACGCTTCCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail