Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1251
Gene name
LocationContig_1272:1650..2936
Strand-
Gene length (bp)1286
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00314 Thaumatin Thaumatin family 1.5E-67 75 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50699|TLPH_ARATH Thaumatin-like protein OS=Arabidopsis thaliana GN=At1g18250 PE=2 SV=2 71 344 5.0E-30
sp|O80327|TLP1_PYRPY Thaumatin-like protein 1 OS=Pyrus pyrifolia GN=TL1 PE=1 SV=1 65 341 2.0E-29
sp|Q9SMH2|TLP1_CASSA Thaumatin-like protein 1 OS=Castanea sativa GN=TL1 PE=2 SV=1 64 341 5.0E-29
sp|Q9FSG7|TP1A_MALDO Thaumatin-like protein 1a OS=Malus domestica GN=TL1 PE=1 SV=1 65 341 1.0E-27
sp|P83332|TLP1_PRUPE Thaumatin-like protein 1 OS=Prunus persica PE=2 SV=1 65 341 1.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50699|TLPH_ARATH Thaumatin-like protein OS=Arabidopsis thaliana GN=At1g18250 PE=2 SV=2 71 344 5.0E-30
sp|O80327|TLP1_PYRPY Thaumatin-like protein 1 OS=Pyrus pyrifolia GN=TL1 PE=1 SV=1 65 341 2.0E-29
sp|Q9SMH2|TLP1_CASSA Thaumatin-like protein 1 OS=Castanea sativa GN=TL1 PE=2 SV=1 64 341 5.0E-29
sp|Q9FSG7|TP1A_MALDO Thaumatin-like protein 1a OS=Malus domestica GN=TL1 PE=1 SV=1 65 341 1.0E-27
sp|P83332|TLP1_PRUPE Thaumatin-like protein 1 OS=Prunus persica PE=2 SV=1 65 341 1.0E-26
sp|P32937|PR1A_HORVU Pathogenesis-related protein 1A/1B OS=Hordeum vulgare PE=2 SV=1 73 182 4.0E-24
sp|P32938|PR1C_HORVU Pathogenesis-related protein 1C OS=Hordeum vulgare PE=2 SV=1 73 182 5.0E-24
sp|P28493|PR5_ARATH Pathogenesis-related protein 5 OS=Arabidopsis thaliana GN=At1g75040 PE=1 SV=1 71 185 3.0E-23
sp|P27357|TLP_WHEAT Thaumatin-like protein PWIR2 OS=Triticum aestivum PE=2 SV=1 73 182 4.0E-22
sp|P33679|ZEAM_MAIZE Zeamatin OS=Zea mays GN=Zlp PE=1 SV=2 67 341 5.0E-22
sp|P81295|PRR3_JUNAS Pathogenesis-related protein OS=Juniperus ashei PE=1 SV=1 69 341 2.0E-21
sp|P83336|TP1B_MALDO Thaumatin-like protein 1b (Fragment) OS=Malus domestica PE=2 SV=1 81 341 3.0E-21
sp|P31110|TLP_ORYSJ Thaumatin-like protein OS=Oryza sativa subsp. japonica GN=Os12g0628600 PE=1 SV=1 65 182 3.0E-20
sp|P13867|IAAT_MAIZE Alpha-amylase/trypsin inhibitor OS=Zea mays PE=1 SV=1 71 341 1.0E-19
sp|P14170|OSMO_TOBAC Osmotin OS=Nicotiana tabacum GN=AP24 PE=1 SV=2 71 345 5.0E-19
sp|Q53MB8|TLPH_ORYSJ Thaumatin-like protein OS=Oryza sativa subsp. japonica GN=Os11g0706600 PE=2 SV=1 69 184 5.0E-19
sp|P50697|RST3_AVESA Thaumatin-like pathogenesis-related protein 3 OS=Avena sativa GN=RASTL-3 PE=2 SV=1 73 182 2.0E-18
sp|P50696|RST2_AVESA Thaumatin-like pathogenesis-related protein 2 OS=Avena sativa GN=RASTL-2 PE=2 SV=1 73 182 2.0E-18
sp|P50695|RST1_AVESA Thaumatin-like pathogenesis-related protein 1 OS=Avena sativa GN=RASTL-1 PE=2 SV=1 73 182 8.0E-18
sp|P50701|OS13_SOLCO Osmotin-like protein OSML13 OS=Solanum commersonii PE=2 SV=1 71 346 9.0E-18
sp|Q01591|TPM1_SOLLC Osmotin-like protein TPM-1 (Fragment) OS=Solanum lycopersicum GN=TPM-1 PE=2 SV=1 73 346 1.0E-17
sp|Q41350|OLP1_SOLLC Osmotin-like protein OS=Solanum lycopersicum PE=1 SV=1 71 184 1.0E-16
sp|P50694|TLP_PRUAV Glucan endo-1,3-beta-glucosidase OS=Prunus avium PE=1 SV=1 65 184 2.0E-16
sp|P25096|P21_SOYBN Protein P21 OS=Glycine max PE=1 SV=1 73 182 7.0E-16
sp|P50702|OS81_SOLCO Osmotin-like protein OSML81 OS=Solanum commersonii PE=2 SV=1 71 343 1.0E-15
sp|P07052|PRR2_TOBAC Pathogenesis-related protein R minor form OS=Nicotiana tabacum PE=2 SV=1 73 182 2.0E-15
sp|P83335|TLP2_PRUPE Thaumatin-like protein 2 OS=Prunus persica PE=2 SV=1 65 184 2.0E-15
sp|P50698|RST4_AVESA Thaumatin-like pathogenesis-related protein 4 OS=Avena sativa GN=RASTL-4 PE=2 SV=1 73 182 5.0E-15
sp|P12670|NP24_SOLLC Protein NP24 OS=Solanum lycopersicum PE=1 SV=2 71 343 1.0E-14
sp|P13046|PRR1_TOBAC Pathogenesis-related protein R major form OS=Nicotiana tabacum PE=1 SV=1 73 182 1.0E-14
sp|G5DC91|TLP1_MANZA Thaumatin-like protein 1 OS=Manilkara zapota GN=TLP1 PE=1 SV=2 73 182 1.0E-13
sp|P25871|OLPA_TOBAC Osmotin-like protein OS=Nicotiana tabacum GN=OLPA PE=1 SV=1 73 356 2.0E-13
sp|P50700|OSL3_ARATH Osmotin-like protein OSM34 OS=Arabidopsis thaliana GN=OSM34 PE=2 SV=2 73 182 5.0E-13
sp|E3SU11|ALL13_OLEEU Thaumatin-like protein OS=Olea europaea PE=1 SV=1 73 182 8.0E-13
sp|P28493|PR5_ARATH Pathogenesis-related protein 5 OS=Arabidopsis thaliana GN=At1g75040 PE=1 SV=1 275 341 3.0E-11
sp|P02883|THM1_THADA Thaumatin-1 OS=Thaumatococcus daniellii PE=1 SV=1 73 182 6.0E-11
sp|P50703|OS35_SOLCO Osmotin-like protein OSML15 OS=Solanum commersonii PE=2 SV=1 73 184 1.0E-10
sp|P02884|THM2_THADA Thaumatin-2 OS=Thaumatococcus daniellii PE=1 SV=1 73 182 2.0E-10
sp|Q53MB8|TLPH_ORYSJ Thaumatin-like protein OS=Oryza sativa subsp. japonica GN=Os11g0706600 PE=2 SV=1 275 325 1.0E-09
sp|P50694|TLP_PRUAV Glucan endo-1,3-beta-glucosidase OS=Prunus avium PE=1 SV=1 275 341 4.0E-09
sp|P81370|TLP_ACTDE Thaumatin-like protein OS=Actinidia deliciosa GN=tlp PE=1 SV=2 73 182 9.0E-09
sp|Q9LD79|PRR3_JUNVI Pathogenesis-related protein (Fragment) OS=Juniperus virginiana PE=1 SV=2 69 158 4.0E-08
sp|P83335|TLP2_PRUPE Thaumatin-like protein 2 OS=Prunus persica PE=2 SV=1 275 341 3.0E-07
sp|P81370|TLP_ACTDE Thaumatin-like protein OS=Actinidia deliciosa GN=tlp PE=1 SV=2 248 341 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1251
MFSLLQSLRIRRFMIHFLFIASTLQLLLPVAEAGQFRVIKRDRQPDILRKPKHGAPAKRGPPQDGEEKIPLVITN
KCDTPIWPGLATQAGTGPGTGGFELQPGTNQTLYVSGDWQGRVWGRTNCTVNGNSCACKTGDCFAKLDCDFSGAP
PATLAEFNLAGGVDGMQTFYDISLVDGYNLPMGIRYLPAKNTTFIPPNLTNCACIATSGWLYAKAPTGTFYANAT
FPVPLEANETNESLGGWCPWPNLAFPPTKPGDGVYPYPDDDVQRPAFSPCKSACATTGSDRDCCIGKYHDPNICK
PSRYSTSVKAVCPDAYSFAFDDQKSTFIVPKGGGWEIVMCPVGRSTNILRQLGKELFELASGGRLSDLSMKRLRD
VGYIEAGRGAASGARAPSWVLAAAPAALAAAWLWL*
Coding >Hirsu2|1251
ATGTTCTCGTTGCTCCAGTCGCTACGAATCCGCCGCTTCATGATCCACTTTCTCTTCATCGCCTCGACACTCCAA
CTGCTGCTGCCCGTTGCAGAGGCAGGCCAGTTTCGTGTCATCAAGCGCGATCGGCAGCCCGACATCCTGAGAAAG
CCCAAGCACGGTGCACCGGCGAAGCGAGGACCGCCGCAAGACGGAGAAGAGAAGATCCCGCTCGTCATCACCAAC
AAGTGCGACACGCCGATATGGCCTGGGCTCGCGACGCAGGCCGGCACCGGCCCGGGTACCGGTGGCTTTGAGTTG
CAGCCGGGCACGAACCAGACTCTGTACGTGTCCGGGGACTGGCAGGGCCGAGTCTGGGGCCGGACCAACTGCACC
GTCAACGGCAATTCCTGCGCCTGCAAGACGGGCGACTGCTTCGCGAAGCTGGACTGCGACTTCAGCGGGGCGCCG
CCGGCGACGCTCGCCGAATTCAACCTGGCAGGCGGCGTCGATGGCATGCAGACCTTTTACGACATATCCCTCGTC
GACGGCTACAACCTGCCCATGGGCATCAGGTATCTGCCGGCGAAGAACACGACGTTCATCCCGCCCAACCTGACG
AATTGCGCCTGCATCGCGACGTCGGGCTGGCTGTACGCCAAGGCGCCGACGGGCACCTTTTATGCCAACGCCACC
TTCCCCGTCCCTCTGGAGGCCAACGAGACGAACGAGAGCCTCGGCGGCTGGTGCCCGTGGCCGAACCTCGCGTTC
CCGCCGACGAAGCCGGGGGACGGCGTCTACCCGTACCCGGACGACGACGTGCAGCGGCCTGCCTTTTCGCCGTGC
AAGAGCGCATGCGCCACGACGGGGTCGGACCGGGACTGCTGCATCGGCAAATACCACGACCCCAACATCTGCAAG
CCGTCGCGGTACAGCACGTCTGTCAAGGCGGTATGCCCGGACGCCTACAGCTTCGCCTTCGACGACCAGAAGTCG
ACTTTTATCGTGCCCAAGGGCGGCGGCTGGGAGATTGTCATGTGCCCGGTCGGGCGCTCGACTAACATTCTGCGC
CAGCTGGGCAAGGAGCTGTTTGAGCTCGCGAGCGGCGGCCGACTGTCGGACCTGTCTATGAAGCGGCTCCGCGAC
GTCGGCTATATCGAGGCCGGCAGGGGGGCCGCGAGCGGGGCGCGGGCCCCGAGCTGGGTGCTGGCGGCGGCGCCG
GCCGCTCTCGCCGCCGCCTGGCTCTGGCTGTGA
Transcript >Hirsu2|1251
ATGTTCTCGTTGCTCCAGTCGCTACGAATCCGCCGCTTCATGATCCACTTTCTCTTCATCGCCTCGACACTCCAA
CTGCTGCTGCCCGTTGCAGAGGCAGGCCAGTTTCGTGTCATCAAGCGCGATCGGCAGCCCGACATCCTGAGAAAG
CCCAAGCACGGTGCACCGGCGAAGCGAGGACCGCCGCAAGACGGAGAAGAGAAGATCCCGCTCGTCATCACCAAC
AAGTGCGACACGCCGATATGGCCTGGGCTCGCGACGCAGGCCGGCACCGGCCCGGGTACCGGTGGCTTTGAGTTG
CAGCCGGGCACGAACCAGACTCTGTACGTGTCCGGGGACTGGCAGGGCCGAGTCTGGGGCCGGACCAACTGCACC
GTCAACGGCAATTCCTGCGCCTGCAAGACGGGCGACTGCTTCGCGAAGCTGGACTGCGACTTCAGCGGGGCGCCG
CCGGCGACGCTCGCCGAATTCAACCTGGCAGGCGGCGTCGATGGCATGCAGACCTTTTACGACATATCCCTCGTC
GACGGCTACAACCTGCCCATGGGCATCAGGTATCTGCCGGCGAAGAACACGACGTTCATCCCGCCCAACCTGACG
AATTGCGCCTGCATCGCGACGTCGGGCTGGCTGTACGCCAAGGCGCCGACGGGCACCTTTTATGCCAACGCCACC
TTCCCCGTCCCTCTGGAGGCCAACGAGACGAACGAGAGCCTCGGCGGCTGGTGCCCGTGGCCGAACCTCGCGTTC
CCGCCGACGAAGCCGGGGGACGGCGTCTACCCGTACCCGGACGACGACGTGCAGCGGCCTGCCTTTTCGCCGTGC
AAGAGCGCATGCGCCACGACGGGGTCGGACCGGGACTGCTGCATCGGCAAATACCACGACCCCAACATCTGCAAG
CCGTCGCGGTACAGCACGTCTGTCAAGGCGGTATGCCCGGACGCCTACAGCTTCGCCTTCGACGACCAGAAGTCG
ACTTTTATCGTGCCCAAGGGCGGCGGCTGGGAGATTGTCATGTGCCCGGTCGGGCGCTCGACTAACATTCTGCGC
CAGCTGGGCAAGGAGCTGTTTGAGCTCGCGAGCGGCGGCCGACTGTCGGACCTGTCTATGAAGCGGCTCCGCGAC
GTCGGCTATATCGAGGCCGGCAGGGGGGCCGCGAGCGGGGCGCGGGCCCCGAGCTGGGTGCTGGCGGCGGCGCCG
GCCGCTCTCGCCGCCGCCTGGCTCTGGCTGTGA
Gene >Hirsu2|1251
ATGTTCTCGTTGCTCCAGTCGCTACGAATCCGCCGCTTCATGATCCACTTTCTCTTCATCGCCTCGACACTCCAA
CTGCTGCTGCCCGTTGCAGAGGCAGGCCAGTTTCGTGTCATCAAGCGCGATCGGCAGCCCGACATCCTGAGAAAG
CCCAAGCACGGTGCACCGGCGAAGCGAGGACCGCCGCAAGACGGAGAAGAGAAGATCCCGCTCGTCATCACCAAC
AAGTGCGACACGCCGATATGGCCTGGGCTCGCGACGCAGGCCGGCACCGGCCCGGGTACCGGTGGCTTTGAGTTG
CAGCCGGGCACGAACCAGACTCTGTACGTGTCCGGGGACTGGCAGGGCCGAGTCTGGGGCCGGACCAACTGCACC
GTCAACGGCAATTCCTGCGCCTGCAAGACGGGCGACTGCTTCGCGAAGCTGGACTGCGACTTCAGCGTAGGTCCC
CCGAGCATGCGTCGCGACGACGAGCTGACGCCCGACGGCTGCAGGGGGCGCCGCCGGCGACGCTCGCCGAATTCA
ACCTGGCAGGCGGCGTCGATGGCATGCAGACCTTTTACGACATATCCCTCGTCGACGGCTACAACCTGCCCATGG
GCATCAGGTATCTGCCGGCGAAGAACACGACGTTCATCCCGCCCAACCTGACGAATTGCGCCTGCATCGCGACGT
CGGGCTGGCTGTACGCCAAGGCGCCGACGGGCACCTTTTATGCCAACGCCACCTTCCCCGTCCCTCTGGAGGCCA
ACGAGACGAACGAGAGCCTCGGCGGCTGGTGCCCGTGGCCGAACCTCGCGTTCCCGCCGACGAAGCCGGGGGACG
GCGTCTACCCGTACCCGGACGACGACGTGCAGCGGCCTGCCTTTTCGCCGTGCAAGAGCGCATGCGCCACGACGG
GGTCGGACCGGGACTGCTGCATCGGCAAATACCACGACCCCAACATCTGCAAGCCGTCGCGGTACAGCACGTCTG
TCAAGGCGGTATGCCCGGACGCCTACAGCTTCGCCTTCGACGACCAGAAGTCGACTTTTATCGTGCCCAAGGGCG
GCGGCTGGGAGATTGTCATGTGCCCGGTCGGGCGCTCGACTAACATTCTGCGCCAGCTGGGCAAGGAGCTGTTTG
AGCTCGCGAGCGGCGGCCGACTGTCGGACCTGTCTATGAAGCGGCTCCGCGACGTCGGCTATATCGAGGCCGGCA
GGGGGGCCGCGAGCGGGGCGCGGGCCCCGAGCTGGGTGCTGGCGGCGGCGCCGGCCGCTCTCGCCGCCGCCTGGC
TCTGGCTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail