Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1250
Gene name
LocationContig_1272:353..1249
Strand+
Gene length (bp)896
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13637 Ank_4 Ankyrin repeats (many copies) 8.5E-07 53 99
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.7E-07 16 100

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53066|YGZ2_YEAST Ankyrin repeat-containing protein YGL242C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL242C PE=1 SV=1 8 137 6.0E-19
sp|Q9P7I0|YIT2_SCHPO Ankyrin repeat-containing protein C105.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC105.02c PE=3 SV=1 8 137 9.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1250
MAGDEEHEGASVAEILIEACRRNNTELLTDTLAGRPDADVSALLNDTTTVMGNHLYHEAASRGNYEIIDLLLDQP
DFECDPTNRSEGDTPLHSAIRWLNGEPPAQRPFGRALVDMMLEAGSSPRARNAAGLTPAQLVDPANPDLRLLIEQ
HLYASQNAGDFANVDDDDDDDRHKQKHKRRGAGEDDAAPAAAPAPAHDDDDDDDAEFSGSDDDERAEWERRRNEK
QHGRAV*
Coding >Hirsu2|1250
ATGGCCGGCGACGAAGAGCACGAGGGCGCCTCCGTCGCCGAGATCTTGATCGAGGCCTGCCGGCGCAACAACACG
GAGCTGCTGACGGACACGCTGGCCGGCCGGCCCGACGCCGACGTCTCGGCCCTGCTCAACGACACGACGACCGTC
ATGGGCAACCACCTGTACCACGAGGCCGCCTCGCGCGGCAACTACGAAATCATCGACCTCCTCCTCGACCAGCCC
GACTTCGAGTGCGACCCCACCAACCGGTCCGAGGGCGACACGCCGCTGCACAGCGCCATCCGCTGGCTCAACGGC
GAGCCGCCCGCCCAGCGGCCCTTCGGCCGCGCCCTCGTCGACATGATGCTCGAGGCCGGCTCCAGCCCGCGCGCC
CGCAACGCCGCCGGCCTGACCCCGGCCCAGCTCGTCGACCCGGCCAACCCGGACCTGCGCCTGCTCATCGAGCAG
CACCTCTACGCCAGCCAGAACGCCGGCGACTTCGCCAACGTCGACGACGACGACGACGACGACCGCCACAAGCAA
AAGCACAAGCGCCGCGGCGCCGGCGAGGACGACGCCGCGCCCGCCGCCGCCCCGGCCCCGGCCCACGACGACGAC
GACGACGACGACGCCGAGTTCAGCGGCAGCGACGACGACGAGCGCGCCGAGTGGGAGCGCAGGAGGAACGAGAAG
CAGCATGGCCGCGCCGTCTGA
Transcript >Hirsu2|1250
ATGGCCGGCGACGAAGAGCACGAGGGCGCCTCCGTCGCCGAGATCTTGATCGAGGCCTGCCGGCGCAACAACACG
GAGCTGCTGACGGACACGCTGGCCGGCCGGCCCGACGCCGACGTCTCGGCCCTGCTCAACGACACGACGACCGTC
ATGGGCAACCACCTGTACCACGAGGCCGCCTCGCGCGGCAACTACGAAATCATCGACCTCCTCCTCGACCAGCCC
GACTTCGAGTGCGACCCCACCAACCGGTCCGAGGGCGACACGCCGCTGCACAGCGCCATCCGCTGGCTCAACGGC
GAGCCGCCCGCCCAGCGGCCCTTCGGCCGCGCCCTCGTCGACATGATGCTCGAGGCCGGCTCCAGCCCGCGCGCC
CGCAACGCCGCCGGCCTGACCCCGGCCCAGCTCGTCGACCCGGCCAACCCGGACCTGCGCCTGCTCATCGAGCAG
CACCTCTACGCCAGCCAGAACGCCGGCGACTTCGCCAACGTCGACGACGACGACGACGACGACCGCCACAAGCAA
AAGCACAAGCGCCGCGGCGCCGGCGAGGACGACGCCGCGCCCGCCGCCGCCCCGGCCCCGGCCCACGACGACGAC
GACGACGACGACGCCGAGTTCAGCGGCAGCGACGACGACGAGCGCGCCGAGTGGGAGCGCAGGAGGAACGAGAAG
CAGCATGGCCGCGCCGTCTGA
Gene >Hirsu2|1250
ATGGCCGGCGACGAAGAGCACGAGGTGAGTGTCCGCCCGCCTGCCGCCGGGGTGGAAAAAAAAAAAGCGGAAGAG
GAGAGCACGGGTGTGTTGTGCGGCCCGCTGACGGGGGAGCGAGCAGGGCGCCTCCGTCGCCGAGATCTTGATCGA
GGCCTGCCGGCGCAACAACACGGAGCTGCTGACGGACACGCTGGCCGGCCGGCCCGACGCCGACGTCTCGGCCCT
GCTCAACGACACGACGACCGTCATGGGCAACCACCTGTACCACGAGGCCGCCTCGCGCGGCAACTGTGCGTGCCG
TCCCGTCCCGTCCCGCGGCGCGGGGGGGAAGAGTCGAAGAGAGAAAGAAAAGAGAGTGTGTGGTGGGAGAGAAGG
CTGACCCATGGGCGGTAGACGAAATCATCGACCTCCTCCTCGACCAGCCCGACTTCGAGTGCGACCCCACCAACC
GGTCCGAGGGCGACACGCCGCTGCACAGCGCCATCCGCTGGCTCAACGGCGAGCCGCCCGCCCAGCGGCCCTTCG
GCCGCGCCCTCGTCGACATGATGCTCGAGGCCGGCTCCAGCCCGCGCGCCCGCAACGCCGCCGGCCTGACCCCGG
CCCAGCTCGTCGACCCGGCCAACCCGGACCTGCGCCTGCTCATCGAGCAGCACCTCTACGCCAGCCAGAACGCCG
GCGACTTCGCCAACGTCGACGACGACGACGACGACGACCGCCACAAGCAAAAGCACAAGCGCCGCGGCGCCGGCG
AGGACGACGCCGCGCCCGCCGCCGCCCCGGCCCCGGCCCACGACGACGACGACGACGACGACGCCGAGTTCAGCG
GCAGCGACGACGACGAGCGCGCCGAGTGGGAGCGCAGGAGGAACGAGAAGCAGCATGGCCGCGCCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail