Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1244
Gene name
LocationContig_127:24773..27622
Strand+
Gene length (bp)2849
Transcript length (bp)2784
Coding sequence length (bp)2784
Protein length (aa) 928

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.7E-07 16 70
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.1E-06 16 45
PF13445 zf-RING_UBOX RING-type zinc-finger 1.9E-06 16 48

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5FWP4|CHFR_XENLA E3 ubiquitin-protein ligase CHFR OS=Xenopus laevis GN=chfr PE=1 SV=1 2 142 4.0E-12
sp|Q6P256|CHFR_XENTR E3 ubiquitin-protein ligase CHFR OS=Xenopus tropicalis GN=chfr PE=2 SV=1 2 142 4.0E-12
sp|A5WW08|CHFR_DANRE E3 ubiquitin-protein ligase CHFR OS=Danio rerio GN=chfr PE=2 SV=1 10 121 4.0E-12
sp|Q96EP1|CHFR_HUMAN E3 ubiquitin-protein ligase CHFR OS=Homo sapiens GN=CHFR PE=1 SV=2 10 142 6.0E-11
sp|Q5RF77|CHFR_PONAB E3 ubiquitin-protein ligase CHFR OS=Pongo abelii GN=CHFR PE=2 SV=1 10 142 8.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5FWP4|CHFR_XENLA E3 ubiquitin-protein ligase CHFR OS=Xenopus laevis GN=chfr PE=1 SV=1 2 142 4.0E-12
sp|Q6P256|CHFR_XENTR E3 ubiquitin-protein ligase CHFR OS=Xenopus tropicalis GN=chfr PE=2 SV=1 2 142 4.0E-12
sp|A5WW08|CHFR_DANRE E3 ubiquitin-protein ligase CHFR OS=Danio rerio GN=chfr PE=2 SV=1 10 121 4.0E-12
sp|Q96EP1|CHFR_HUMAN E3 ubiquitin-protein ligase CHFR OS=Homo sapiens GN=CHFR PE=1 SV=2 10 142 6.0E-11
sp|Q5RF77|CHFR_PONAB E3 ubiquitin-protein ligase CHFR OS=Pongo abelii GN=CHFR PE=2 SV=1 10 142 8.0E-11
sp|Q810L3|CHFR_MOUSE E3 ubiquitin-protein ligase CHFR OS=Mus musculus GN=Chfr PE=1 SV=1 10 140 2.0E-10
sp|Q58D15|TRI54_BOVIN Tripartite motif-containing protein 54 OS=Bos taurus GN=TRIM54 PE=2 SV=1 9 90 2.0E-07
sp|Q9ERP3|TRI54_MOUSE Tripartite motif-containing protein 54 OS=Mus musculus GN=Trim54 PE=1 SV=1 9 101 2.0E-07
sp|Q5REJ9|TRI54_PONAB Tripartite motif-containing protein 54 OS=Pongo abelii GN=TRIM54 PE=2 SV=1 9 90 2.0E-07
sp|Q9BYV2|TRI54_HUMAN Tripartite motif-containing protein 54 OS=Homo sapiens GN=TRIM54 PE=1 SV=3 9 90 2.0E-07
sp|Q5XIH6|TRI54_RAT Tripartite motif-containing protein 54 OS=Rattus norvegicus GN=Trim54 PE=2 SV=1 9 90 3.0E-07
sp|Q2YEM8|TRIM5_HOOHO Tripartite motif-containing protein 5 OS=Hoolock hoolock GN=TRIM5 PE=3 SV=1 8 87 2.0E-06
sp|Q9BYV6|TRI55_HUMAN Tripartite motif-containing protein 55 OS=Homo sapiens GN=TRIM55 PE=1 SV=2 9 90 2.0E-06
sp|Q5PQN5|TRI55_RAT Tripartite motif-containing protein 55 OS=Rattus norvegicus GN=Trim55 PE=1 SV=1 9 90 2.0E-06
sp|Q38HM4|TRI63_MOUSE E3 ubiquitin-protein ligase TRIM63 OS=Mus musculus GN=Trim63 PE=1 SV=1 9 104 2.0E-06
sp|Q969Q1|TRI63_HUMAN E3 ubiquitin-protein ligase TRIM63 OS=Homo sapiens GN=TRIM63 PE=1 SV=1 6 104 2.0E-06
sp|Q91Z63|TRI63_RAT E3 ubiquitin-protein ligase TRIM63 OS=Rattus norvegicus GN=Trim63 PE=2 SV=1 9 104 2.0E-06
sp|Q1ACD7|TRIM5_NOMLE Tripartite motif-containing protein 5 OS=Nomascus leucogenys GN=TRIM5 PE=3 SV=1 8 87 4.0E-06
sp|Q1ACD6|TRIM5_SYMSY Tripartite motif-containing protein 5 OS=Symphalangus syndactylus GN=TRIM5 PE=3 SV=1 8 87 5.0E-06
sp|Q8IYM9|TRI22_HUMAN E3 ubiquitin-protein ligase TRIM22 OS=Homo sapiens GN=TRIM22 PE=1 SV=1 8 112 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1244
MESRKPSLDLEKELTCSICTELLYQPLTLLDCLHTFCGACLKEWFGFQALTAERAPTPPEPGAVFTCPSCRSAVR
DSRHNATVVTLLDMFVAAHPAKARTEDDKEEMARKYQPGDQVLPKLNVREPTADDRQAQEEDRRLLEQVREMSLR
EATTGLPQPLRLRRRRESSSADDRPRSGRNQSVDDGHARRPREGSRRPRADEAARHGTNLPSEDRERRRRDSGDT
WQRHVEHQSSLRSLIGSANMGERDIEREIEEFARQIQEEGLLDGLDLDNIDLTRDDELSRRVTEAYRRRQRERSR
QEATRRGNGGAARRAESTSADARRRAPENGARAGSRPRTGSRPASGNGQAEDRSRPPLANAPNLEVRDPARRARR
RTSSGGRSATTPLFLPGPEARPAARSQTDLVSRTHTSDPSTPRHGFGERRSSSTPSVPAAVVPPAEPPVPAGTGN
NASFANRVPQWNLTAAEPPPARTHEPSPAHVRRASDLAIVHSVVSSPISSPAALGHQRTRSQLYPEPSISCSRCD
RTHIEYELHYNCATCAAGQWNICLDCYRAGKGCLYWFGFGYGAWSKWEKAQQQDETLARPHILTASRYLPPPSTP
GGADGRKTLTANDPRTRLETGTFCARCFACTNGCYWRCDVCNEGDWGYCNNCVNQGKSCTHMLLPLTHEPAQPGA
RPRSPRSLDRPTAATILSGPQASNMGPFKPLTFRTRCDVCREAMAPSQIRYHCFSCTSALAPDAPPGDLDICPPC
YGNLVAQGQISAENGHSGWRRCLHGHRMVVIGFADGKVGQWRYVERDLVGGRALRSEPFEGPDQHGGGRGLQVWS
WRAGGDGTRQRLVATDVAAAAPAMLSPGVLAHGFPPDGGTGMRAVARWAWYPHAKADDELLFPRGAEVREVEDVN
GDWFFGTYMGAKGLFPAPYVRLAEQGP*
Coding >Hirsu2|1244
ATGGAGTCTCGAAAGCCCAGTCTGGACCTGGAGAAGGAGTTGACGTGCTCTATCTGCACCGAGCTCCTCTACCAG
CCGCTGACGCTGCTCGACTGTCTGCATACCTTCTGCGGAGCCTGCCTGAAGGAATGGTTCGGCTTCCAGGCGCTG
ACCGCCGAGAGGGCCCCGACGCCCCCCGAGCCCGGAGCCGTCTTCACCTGCCCGTCGTGCCGGAGCGCCGTGCGA
GACTCGCGACACAATGCCACCGTCGTCACCCTGCTCGACATGTTCGTCGCCGCCCACCCGGCCAAGGCCCGGACC
GAGGATGACAAGGAGGAGATGGCGCGCAAGTACCAGCCGGGCGACCAGGTCCTGCCCAAGCTCAACGTTCGTGAG
CCGACGGCCGACGACCGGCAGGCCCAAGAGGAGGACCGGCGGCTGTTGGAACAAGTCAGGGAGATGAGCCTGCGC
GAGGCCACCACCGGCCTGCCGCAGCCGCTCAGGCTCCGCCGCCGCCGAGAGAGCTCCTCCGCCGACGACCGCCCC
CGATCCGGCCGGAACCAGAGCGTCGACGACGGCCACGCGCGACGCCCGCGAGAGGGCAGCCGTCGCCCCCGCGCC
GACGAGGCCGCTCGTCACGGCACGAACCTGCCGTCCGAGGACAGAGAGCGGAGGCGACGGGATTCCGGGGACACG
TGGCAGCGCCACGTCGAGCACCAGTCGTCGCTGCGCTCCTTGATCGGCTCTGCCAACATGGGCGAGCGCGACATT
GAGAGGGAAATCGAGGAGTTTGCGCGCCAGATCCAGGAGGAGGGACTGCTCGACGGCCTGGACCTCGACAACATC
GACCTGACCCGCGATGACGAGCTGAGCCGCCGCGTCACCGAGGCCTACCGTCGACGCCAGCGAGAGCGATCGCGA
CAAGAGGCCACGAGGCGGGGCAACGGCGGCGCGGCGCGACGGGCCGAGTCGACCTCGGCCGACGCGCGACGCCGT
GCGCCGGAGAACGGGGCCAGAGCCGGGAGCCGCCCTCGCACAGGGTCCAGGCCGGCCAGCGGAAACGGCCAGGCC
GAGGACCGCAGCAGGCCGCCCCTGGCCAACGCCCCGAATCTCGAGGTGCGCGATCCCGCCCGGAGGGCTCGGAGG
CGGACCTCGAGCGGCGGCCGCAGTGCCACTACGCCACTCTTCCTCCCCGGGCCCGAAGCCCGGCCGGCGGCTCGT
TCCCAGACGGACCTCGTCTCCAGGACCCACACCTCCGATCCATCGACGCCGCGACACGGCTTCGGCGAGCGCCGC
AGCTCCAGCACGCCTTCCGTGCCGGCCGCGGTGGTGCCCCCGGCCGAGCCGCCGGTCCCCGCCGGCACGGGCAAC
AACGCGTCCTTCGCCAACCGAGTGCCGCAGTGGAATCTGACGGCGGCAGAGCCTCCTCCCGCCCGCACACACGAG
CCGAGCCCGGCGCATGTGCGTCGGGCATCAGACCTCGCCATCGTGCACTCGGTCGTGTCGAGCCCCATCAGCAGC
CCTGCGGCTTTGGGCCACCAACGCACCAGGTCGCAGCTCTACCCCGAGCCGTCCATCAGCTGCTCGCGGTGCGAC
AGGACGCACATCGAGTACGAGCTGCACTACAACTGCGCCACCTGCGCAGCCGGGCAGTGGAACATCTGCCTGGAC
TGCTACCGCGCCGGCAAGGGCTGCCTCTACTGGTTCGGCTTCGGCTACGGCGCCTGGAGCAAGTGGGAGAAGGCG
CAGCAGCAGGACGAGACGCTGGCTAGGCCACACATCCTCACGGCAAGCCGTTATCTCCCGCCGCCGTCGACGCCG
GGCGGTGCCGACGGCAGGAAGACGCTGACGGCCAACGACCCCCGGACGAGGCTGGAGACGGGCACGTTCTGCGCG
CGATGCTTCGCCTGCACCAACGGCTGCTACTGGCGCTGCGACGTCTGCAACGAGGGCGACTGGGGGTACTGCAAC
AACTGCGTGAACCAGGGCAAGTCGTGCACCCACATGCTTCTGCCCCTGACCCACGAGCCGGCCCAGCCCGGCGCC
CGGCCACGCAGCCCGAGATCGCTGGACAGGCCGACGGCGGCGACGATCCTCAGCGGGCCCCAGGCCTCCAACATG
GGCCCGTTCAAGCCGCTGACGTTCCGGACGAGGTGCGACGTCTGCCGCGAGGCCATGGCGCCCTCGCAGATCCGG
TACCACTGCTTCAGCTGCACGAGCGCCCTCGCGCCGGACGCGCCGCCGGGGGACCTCGACATCTGCCCGCCCTGC
TACGGCAACCTCGTCGCCCAGGGGCAGATCAGCGCGGAGAACGGCCACTCGGGGTGGCGGAGGTGCCTCCACGGC
CACCGGATGGTCGTCATCGGCTTCGCGGACGGCAAGGTCGGACAGTGGCGGTACGTCGAGCGGGACCTCGTCGGC
GGGCGCGCGCTGCGGTCCGAGCCCTTCGAGGGGCCGGACCAGCACGGCGGCGGCCGGGGCCTTCAGGTGTGGTCG
TGGCGCGCGGGCGGCGACGGGACGCGGCAGCGCCTCGTGGCCACGGACGTGGCGGCGGCGGCGCCCGCGATGCTC
AGCCCCGGCGTCCTGGCCCACGGCTTCCCGCCGGACGGCGGCACGGGCATGCGGGCGGTCGCGCGCTGGGCCTGG
TACCCGCACGCCAAGGCCGACGACGAGCTGCTGTTCCCGCGGGGCGCCGAGGTGCGTGAGGTCGAGGACGTCAAC
GGCGACTGGTTCTTTGGCACGTACATGGGAGCCAAGGGGCTGTTTCCGGCGCCATACGTCCGCCTGGCGGAGCAG
GGCCCGTGA
Transcript >Hirsu2|1244
ATGGAGTCTCGAAAGCCCAGTCTGGACCTGGAGAAGGAGTTGACGTGCTCTATCTGCACCGAGCTCCTCTACCAG
CCGCTGACGCTGCTCGACTGTCTGCATACCTTCTGCGGAGCCTGCCTGAAGGAATGGTTCGGCTTCCAGGCGCTG
ACCGCCGAGAGGGCCCCGACGCCCCCCGAGCCCGGAGCCGTCTTCACCTGCCCGTCGTGCCGGAGCGCCGTGCGA
GACTCGCGACACAATGCCACCGTCGTCACCCTGCTCGACATGTTCGTCGCCGCCCACCCGGCCAAGGCCCGGACC
GAGGATGACAAGGAGGAGATGGCGCGCAAGTACCAGCCGGGCGACCAGGTCCTGCCCAAGCTCAACGTTCGTGAG
CCGACGGCCGACGACCGGCAGGCCCAAGAGGAGGACCGGCGGCTGTTGGAACAAGTCAGGGAGATGAGCCTGCGC
GAGGCCACCACCGGCCTGCCGCAGCCGCTCAGGCTCCGCCGCCGCCGAGAGAGCTCCTCCGCCGACGACCGCCCC
CGATCCGGCCGGAACCAGAGCGTCGACGACGGCCACGCGCGACGCCCGCGAGAGGGCAGCCGTCGCCCCCGCGCC
GACGAGGCCGCTCGTCACGGCACGAACCTGCCGTCCGAGGACAGAGAGCGGAGGCGACGGGATTCCGGGGACACG
TGGCAGCGCCACGTCGAGCACCAGTCGTCGCTGCGCTCCTTGATCGGCTCTGCCAACATGGGCGAGCGCGACATT
GAGAGGGAAATCGAGGAGTTTGCGCGCCAGATCCAGGAGGAGGGACTGCTCGACGGCCTGGACCTCGACAACATC
GACCTGACCCGCGATGACGAGCTGAGCCGCCGCGTCACCGAGGCCTACCGTCGACGCCAGCGAGAGCGATCGCGA
CAAGAGGCCACGAGGCGGGGCAACGGCGGCGCGGCGCGACGGGCCGAGTCGACCTCGGCCGACGCGCGACGCCGT
GCGCCGGAGAACGGGGCCAGAGCCGGGAGCCGCCCTCGCACAGGGTCCAGGCCGGCCAGCGGAAACGGCCAGGCC
GAGGACCGCAGCAGGCCGCCCCTGGCCAACGCCCCGAATCTCGAGGTGCGCGATCCCGCCCGGAGGGCTCGGAGG
CGGACCTCGAGCGGCGGCCGCAGTGCCACTACGCCACTCTTCCTCCCCGGGCCCGAAGCCCGGCCGGCGGCTCGT
TCCCAGACGGACCTCGTCTCCAGGACCCACACCTCCGATCCATCGACGCCGCGACACGGCTTCGGCGAGCGCCGC
AGCTCCAGCACGCCTTCCGTGCCGGCCGCGGTGGTGCCCCCGGCCGAGCCGCCGGTCCCCGCCGGCACGGGCAAC
AACGCGTCCTTCGCCAACCGAGTGCCGCAGTGGAATCTGACGGCGGCAGAGCCTCCTCCCGCCCGCACACACGAG
CCGAGCCCGGCGCATGTGCGTCGGGCATCAGACCTCGCCATCGTGCACTCGGTCGTGTCGAGCCCCATCAGCAGC
CCTGCGGCTTTGGGCCACCAACGCACCAGGTCGCAGCTCTACCCCGAGCCGTCCATCAGCTGCTCGCGGTGCGAC
AGGACGCACATCGAGTACGAGCTGCACTACAACTGCGCCACCTGCGCAGCCGGGCAGTGGAACATCTGCCTGGAC
TGCTACCGCGCCGGCAAGGGCTGCCTCTACTGGTTCGGCTTCGGCTACGGCGCCTGGAGCAAGTGGGAGAAGGCG
CAGCAGCAGGACGAGACGCTGGCTAGGCCACACATCCTCACGGCAAGCCGTTATCTCCCGCCGCCGTCGACGCCG
GGCGGTGCCGACGGCAGGAAGACGCTGACGGCCAACGACCCCCGGACGAGGCTGGAGACGGGCACGTTCTGCGCG
CGATGCTTCGCCTGCACCAACGGCTGCTACTGGCGCTGCGACGTCTGCAACGAGGGCGACTGGGGGTACTGCAAC
AACTGCGTGAACCAGGGCAAGTCGTGCACCCACATGCTTCTGCCCCTGACCCACGAGCCGGCCCAGCCCGGCGCC
CGGCCACGCAGCCCGAGATCGCTGGACAGGCCGACGGCGGCGACGATCCTCAGCGGGCCCCAGGCCTCCAACATG
GGCCCGTTCAAGCCGCTGACGTTCCGGACGAGGTGCGACGTCTGCCGCGAGGCCATGGCGCCCTCGCAGATCCGG
TACCACTGCTTCAGCTGCACGAGCGCCCTCGCGCCGGACGCGCCGCCGGGGGACCTCGACATCTGCCCGCCCTGC
TACGGCAACCTCGTCGCCCAGGGGCAGATCAGCGCGGAGAACGGCCACTCGGGGTGGCGGAGGTGCCTCCACGGC
CACCGGATGGTCGTCATCGGCTTCGCGGACGGCAAGGTCGGACAGTGGCGGTACGTCGAGCGGGACCTCGTCGGC
GGGCGCGCGCTGCGGTCCGAGCCCTTCGAGGGGCCGGACCAGCACGGCGGCGGCCGGGGCCTTCAGGTGTGGTCG
TGGCGCGCGGGCGGCGACGGGACGCGGCAGCGCCTCGTGGCCACGGACGTGGCGGCGGCGGCGCCCGCGATGCTC
AGCCCCGGCGTCCTGGCCCACGGCTTCCCGCCGGACGGCGGCACGGGCATGCGGGCGGTCGCGCGCTGGGCCTGG
TACCCGCACGCCAAGGCCGACGACGAGCTGCTGTTCCCGCGGGGCGCCGAGGTGCGTGAGGTCGAGGACGTCAAC
GGCGACTGGTTCTTTGGCACGTACATGGGAGCCAAGGGGCTGTTTCCGGCGCCATACGTCCGCCTGGCGGAGCAG
GGCCCGTGA
Gene >Hirsu2|1244
ATGGAGTCTCGAAAGCCCAGTCTGGACCTGGAGAAGGAGTTGACGTGCTCTGTACCTTGGCCCGAACTTGTCCCC
GCCTCTCCGTCGCCCGCTGCCACTGACGAAGCCGCCTGCAGATCTGCACCGAGCTCCTCTACCAGCCGCTGACGC
TGCTCGACTGTCTGCATACCTTCTGCGGAGCCTGCCTGAAGGAATGGTTCGGCTTCCAGGCGCTGACCGCCGAGA
GGGCCCCGACGCCCCCCGAGCCCGGAGCCGTCTTCACCTGCCCGTCGTGCCGGAGCGCCGTGCGAGACTCGCGAC
ACAATGCCACCGTCGTCACCCTGCTCGACATGTTCGTCGCCGCCCACCCGGCCAAGGCCCGGACCGAGGATGACA
AGGAGGAGATGGCGCGCAAGTACCAGCCGGGCGACCAGGTCCTGCCCAAGCTCAACGTTCGTGAGCCGACGGCCG
ACGACCGGCAGGCCCAAGAGGAGGACCGGCGGCTGTTGGAACAAGTCAGGGAGATGAGCCTGCGCGAGGCCACCA
CCGGCCTGCCGCAGCCGCTCAGGCTCCGCCGCCGCCGAGAGAGCTCCTCCGCCGACGACCGCCCCCGATCCGGCC
GGAACCAGAGCGTCGACGACGGCCACGCGCGACGCCCGCGAGAGGGCAGCCGTCGCCCCCGCGCCGACGAGGCCG
CTCGTCACGGCACGAACCTGCCGTCCGAGGACAGAGAGCGGAGGCGACGGGATTCCGGGGACACGTGGCAGCGCC
ACGTCGAGCACCAGTCGTCGCTGCGCTCCTTGATCGGCTCTGCCAACATGGGCGAGCGCGACATTGAGAGGGAAA
TCGAGGAGTTTGCGCGCCAGATCCAGGAGGAGGGACTGCTCGACGGCCTGGACCTCGACAACATCGACCTGACCC
GCGATGACGAGCTGAGCCGCCGCGTCACCGAGGCCTACCGTCGACGCCAGCGAGAGCGATCGCGACAAGAGGCCA
CGAGGCGGGGCAACGGCGGCGCGGCGCGACGGGCCGAGTCGACCTCGGCCGACGCGCGACGCCGTGCGCCGGAGA
ACGGGGCCAGAGCCGGGAGCCGCCCTCGCACAGGGTCCAGGCCGGCCAGCGGAAACGGCCAGGCCGAGGACCGCA
GCAGGCCGCCCCTGGCCAACGCCCCGAATCTCGAGGTGCGCGATCCCGCCCGGAGGGCTCGGAGGCGGACCTCGA
GCGGCGGCCGCAGTGCCACTACGCCACTCTTCCTCCCCGGGCCCGAAGCCCGGCCGGCGGCTCGTTCCCAGACGG
ACCTCGTCTCCAGGACCCACACCTCCGATCCATCGACGCCGCGACACGGCTTCGGCGAGCGCCGCAGCTCCAGCA
CGCCTTCCGTGCCGGCCGCGGTGGTGCCCCCGGCCGAGCCGCCGGTCCCCGCCGGCACGGGCAACAACGCGTCCT
TCGCCAACCGAGTGCCGCAGTGGAATCTGACGGCGGCAGAGCCTCCTCCCGCCCGCACACACGAGCCGAGCCCGG
CGCATGTGCGTCGGGCATCAGACCTCGCCATCGTGCACTCGGTCGTGTCGAGCCCCATCAGCAGCCCTGCGGCTT
TGGGCCACCAACGCACCAGGTCGCAGCTCTACCCCGAGCCGTCCATCAGCTGCTCGCGGTGCGACAGGACGCACA
TCGAGTACGAGCTGCACTACAACTGCGCCACCTGCGCAGCCGGGCAGTGGAACATCTGCCTGGACTGCTACCGCG
CCGGCAAGGGCTGCCTCTACTGGTTCGGCTTCGGCTACGGCGCCTGGAGCAAGTGGGAGAAGGCGCAGCAGCAGG
ACGAGACGCTGGCTAGGCCACACATCCTCACGGCAAGCCGTTATCTCCCGCCGCCGTCGACGCCGGGCGGTGCCG
ACGGCAGGAAGACGCTGACGGCCAACGACCCCCGGACGAGGCTGGAGACGGGCACGTTCTGCGCGCGATGCTTCG
CCTGCACCAACGGCTGCTACTGGCGCTGCGACGTCTGCAACGAGGGCGACTGGGGGTACTGCAACAACTGCGTGA
ACCAGGGCAAGTCGTGCACCCACATGCTTCTGCCCCTGACCCACGAGCCGGCCCAGCCCGGCGCCCGGCCACGCA
GCCCGAGATCGCTGGACAGGCCGACGGCGGCGACGATCCTCAGCGGGCCCCAGGCCTCCAACATGGGCCCGTTCA
AGCCGCTGACGTTCCGGACGAGGTGCGACGTCTGCCGCGAGGCCATGGCGCCCTCGCAGATCCGGTACCACTGCT
TCAGCTGCACGAGCGCCCTCGCGCCGGACGCGCCGCCGGGGGACCTCGACATCTGCCCGCCCTGCTACGGCAACC
TCGTCGCCCAGGGGCAGATCAGCGCGGAGAACGGCCACTCGGGGTGGCGGAGGTGCCTCCACGGCCACCGGATGG
TCGTCATCGGCTTCGCGGACGGCAAGGTCGGACAGTGGCGGTACGTCGAGCGGGACCTCGTCGGCGGGCGCGCGC
TGCGGTCCGAGCCCTTCGAGGGGCCGGACCAGCACGGCGGCGGCCGGGGCCTTCAGGTGTGGTCGTGGCGCGCGG
GCGGCGACGGGACGCGGCAGCGCCTCGTGGCCACGGACGTGGCGGCGGCGGCGCCCGCGATGCTCAGCCCCGGCG
TCCTGGCCCACGGCTTCCCGCCGGACGGCGGCACGGGCATGCGGGCGGTCGCGCGCTGGGCCTGGTACCCGCACG
CCAAGGCCGACGACGAGCTGCTGTTCCCGCGGGGCGCCGAGGTGCGTGAGGTCGAGGACGTCAACGGCGACTGGT
TCTTTGGCACGTACATGGGAGCCAAGGGGCTGTTTCCGGCGCCATACGTCCGCCTGGCGGAGCAGGGCCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail