Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|124
Gene name
LocationContig_102:5993..6424
Strand-
Gene length (bp)431
Transcript length (bp)381
Coding sequence length (bp)381
Protein length (aa) 127

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular Signal peptide 0.5061 0.2976 0.653 0.0708 0.2768 0.0658 0.1491 0.3099 0.3537 0.2178

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6487
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|10312
Ophiocordyceps subramaniannii Hirsu2|124 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8185
Ophiocordyceps subramaniannii Hirsu2|9415

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|124
MPANSRINRKLGLNQVFPDESDGFVDTALDIIAIHGLDTQSPRAWVAWKKDGDPDSGHVHWLQDRDMLPSVIPNA
RIFTYDWNANIDNDAAADFLFGHADALLDRLLIRRSKATQNLKPSSSPGIG*
Coding >Hirsu2|124
ATGCCGGCGAACAGCAGAATTAACCGAAAACTCGGGCTGAACCAAGTTTTCCCCGACGAAAGCGATGGCTTCGTC
GACACGGCATTAGACATCATCGCCATCCACGGCCTGGACACCCAATCGCCGAGAGCTTGGGTGGCGTGGAAGAAG
GATGGTGACCCGGATTCGGGGCACGTCCACTGGCTACAGGACAGGGATATGCTGCCTTCTGTCATCCCGAACGCC
CGCATCTTTACATACGACTGGAACGCGAATATCGACAACGATGCAGCCGCCGACTTTCTATTCGGCCATGCCGAT
GCCCTGCTAGATAGGCTACTTATCCGCAGATCTAAGGCAACGCAAAACCTCAAGCCTTCATCTTCGCCTGGCATC
GGCTAA
Transcript >Hirsu2|124
ATGCCGGCGAACAGCAGAATTAACCGAAAACTCGGGCTGAACCAAGTTTTCCCCGACGAAAGCGATGGCTTCGTC
GACACGGCATTAGACATCATCGCCATCCACGGCCTGGACACCCAATCGCCGAGAGCTTGGGTGGCGTGGAAGAAG
GATGGTGACCCGGATTCGGGGCACGTCCACTGGCTACAGGACAGGGATATGCTGCCTTCTGTCATCCCGAACGCC
CGCATCTTTACATACGACTGGAACGCGAATATCGACAACGATGCAGCCGCCGACTTTCTATTCGGCCATGCCGAT
GCCCTGCTAGATAGGCTACTTATCCGCAGATCTAAGGCAACGCAAAACCTCAAGCCTTCATCTTCGCCTGGCATC
GGCTAA
Gene >Hirsu2|124
ATGCCGGCGAACAGCAGAATTAACCGAAAACTCGGGCTGAACCAAGTTTTCCCCGACGAAAGCGATGGCTTCGTC
GACACGGCATTAGAGTCCGTTGGTTTCTCGTGCCAGTTTTGCCAATATCTCTAATCAAGAGCAGCATCATCGCCA
TCCACGGCCTGGACACCCAATCGCCGAGAGCTTGGGTGGCGTGGAAGAAGGATGGTGACCCGGATTCGGGGCACG
TCCACTGGCTACAGGACAGGGATATGCTGCCTTCTGTCATCCCGAACGCCCGCATCTTTACATACGACTGGAACG
CGAATATCGACAACGATGCAGCCGCCGACTTTCTATTCGGCCATGCCGATGCCCTGCTAGATAGGCTACTTATCC
GCAGATCTAAGGCAACGCAAAACCTCAAGCCTTCATCTTCGCCTGGCATCGGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail