Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1239
Gene name
LocationContig_127:4936..7508
Strand-
Gene length (bp)2572
Transcript length (bp)1848
Coding sequence length (bp)1848
Protein length (aa) 616

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.4E-43 107 502
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 2.6E-18 95 495
PF00083 Sugar_tr Sugar (and other) transporter 1.5E-15 113 271

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 107 603 9.0E-60
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 76 603 3.0E-59
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 74 610 4.0E-55
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 92 601 7.0E-54
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 92 601 7.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 107 603 9.0E-60
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 76 603 3.0E-59
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 74 610 4.0E-55
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 92 601 7.0E-54
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 92 601 7.0E-54
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 92 610 3.0E-51
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 108 518 5.0E-48
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 96 531 1.0E-46
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 123 524 3.0E-39
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 112 582 5.0E-39
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 55 512 2.0E-37
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 186 531 9.0E-37
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 123 511 1.0E-33
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 107 577 2.0E-31
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 142 613 2.0E-28
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 107 576 4.0E-27
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 107 576 4.0E-27
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 52 563 1.0E-26
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 99 512 1.0E-24
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 134 596 2.0E-24
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 125 613 6.0E-24
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 66 464 1.0E-23
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 66 517 2.0E-23
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 81 586 3.0E-23
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 92 512 2.0E-22
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 92 512 2.0E-22
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 107 512 2.0E-21
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 72 512 3.0E-21
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 72 512 3.0E-21
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 113 569 9.0E-20
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 53 549 1.0E-19
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 82 512 2.0E-19
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 40 614 3.0E-19
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 92 516 4.0E-19
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 90 512 5.0E-18
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 131 586 1.0E-17
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 131 586 6.0E-17
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 107 506 2.0E-16
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 96 509 3.0E-16
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 111 404 4.0E-16
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 111 404 4.0E-16
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 111 404 4.0E-16
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 111 404 4.0E-16
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 111 404 4.0E-16
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 111 404 4.0E-16
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 111 404 4.0E-16
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 111 404 4.0E-16
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 124 601 4.0E-16
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 171 542 1.0E-15
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 142 601 1.0E-15
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 129 511 2.0E-15
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 129 511 2.0E-15
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 92 594 3.0E-15
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 111 404 3.0E-15
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 58 509 3.0E-15
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 111 442 5.0E-15
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 111 404 2.0E-14
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 90 410 3.0E-14
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 98 512 5.0E-14
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 111 404 6.0E-14
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 110 513 9.0E-14
sp|P62967|TCR_STAES Tetracycline resistance protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tet PE=3 SV=1 105 317 1.0E-13
sp|P02983|TCR_STAAU Tetracycline resistance protein OS=Staphylococcus aureus GN=tet PE=3 SV=3 105 317 1.0E-13
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 140 520 5.0E-13
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 107 421 5.0E-13
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 100 608 5.0E-13
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 143 428 6.0E-13
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 105 298 7.0E-13
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 105 298 7.0E-13
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 105 298 7.0E-13
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 105 298 8.0E-13
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 111 450 9.0E-13
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 93 507 1.0E-12
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 107 501 2.0E-12
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 111 450 2.0E-12
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 111 533 2.0E-12
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 96 509 2.0E-12
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 111 450 2.0E-12
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 111 450 2.0E-12
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 111 450 3.0E-12
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 111 450 3.0E-12
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 111 450 3.0E-12
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 111 450 3.0E-12
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 105 306 3.0E-12
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 104 528 5.0E-12
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 111 450 5.0E-12
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 111 450 6.0E-12
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 111 450 8.0E-12
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 105 298 1.0E-11
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 140 404 1.0E-11
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 152 599 2.0E-11
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 111 450 2.0E-11
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 83 509 2.0E-11
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 83 509 2.0E-11
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 140 404 5.0E-11
sp|A7MHI9|MDTD_CROS8 Putative multidrug resistance protein MdtD OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mdtD PE=3 SV=1 111 404 6.0E-11
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 105 251 6.0E-11
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 26 512 7.0E-11
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 142 519 9.0E-11
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 92 512 1.0E-10
sp|Q7ZU13|SPNS1_DANRE Protein spinster homolog 1 OS=Danio rerio GN=spns1 PE=2 SV=1 92 258 2.0E-10
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 111 450 3.0E-10
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 123 274 3.0E-10
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 123 274 3.0E-10
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 123 274 3.0E-10
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 123 274 3.0E-10
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 123 274 3.0E-10
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 123 274 3.0E-10
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 123 274 3.0E-10
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 123 274 3.0E-10
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 55 265 6.0E-10
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 133 510 9.0E-10
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 120 308 1.0E-09
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 39 274 1.0E-09
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 66 265 2.0E-09
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 66 265 2.0E-09
sp|A2CER7|SPNS3_DANRE Protein spinster homolog 3 OS=Danio rerio GN=spns3 PE=2 SV=1 85 274 3.0E-09
sp|Q8FG02|MDTD_ECOL6 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtD PE=3 SV=1 111 450 4.0E-09
sp|Q9GQQ0|SPIN_DROME Protein spinster OS=Drosophila melanogaster GN=spin PE=1 SV=1 105 258 1.0E-08
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 146 259 1.0E-08
sp|B7MWZ0|MDTD_ECO81 Putative multidrug resistance protein MdtD OS=Escherichia coli O81 (strain ED1a) GN=mdtD PE=3 SV=1 111 440 1.0E-08
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 115 288 1.0E-08
sp|Q5XGK0|SPNS1_XENLA Protein spinster homolog 1 OS=Xenopus laevis GN=spns1 PE=2 SV=1 92 258 2.0E-08
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 146 253 2.0E-08
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 140 255 2.0E-08
sp|P14551|TCR_STRRM Tetracycline resistance determinant OS=Streptomyces rimosus GN=tetB PE=3 SV=1 312 606 2.0E-08
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 77 421 2.0E-08
sp|Q1R9Z4|MDTD_ECOUT Putative multidrug resistance protein MdtD OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtD PE=3 SV=1 111 450 2.0E-08
sp|B7ME89|MDTD_ECO45 Putative multidrug resistance protein MdtD OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtD PE=3 SV=1 111 450 2.0E-08
sp|B7UTB5|MDTD_ECO27 Putative multidrug resistance protein MdtD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtD PE=3 SV=1 111 450 3.0E-08
sp|Q3Z0C7|MDTD_SHISS Putative multidrug resistance protein MdtD OS=Shigella sonnei (strain Ss046) GN=mdtD PE=3 SV=1 111 450 3.0E-08
sp|B5YUD5|MDTD_ECO5E Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtD PE=3 SV=1 111 450 3.0E-08
sp|Q8X7I3|MDTD_ECO57 Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 GN=mdtD PE=3 SV=1 111 450 3.0E-08
sp|A8WGF7|SPNS1_XENTR Protein spinster homolog 1 OS=Xenopus tropicalis GN=spns1 PE=2 SV=2 38 258 3.0E-08
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 46 509 3.0E-08
sp|A1ACT2|MDTD_ECOK1 Putative multidrug resistance protein MdtD OS=Escherichia coli O1:K1 / APEC GN=mdtD PE=3 SV=1 111 450 4.0E-08
sp|B2TYA6|MDTD_SHIB3 Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtD PE=3 SV=1 111 450 4.0E-08
sp|P36554|MDTD_ECOLI Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12) GN=mdtD PE=1 SV=2 111 450 4.0E-08
sp|B1IYZ7|MDTD_ECOLC Putative multidrug resistance protein MdtD OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtD PE=3 SV=1 111 450 4.0E-08
sp|A8A1U9|MDTD_ECOHS Putative multidrug resistance protein MdtD OS=Escherichia coli O9:H4 (strain HS) GN=mdtD PE=3 SV=1 111 450 4.0E-08
sp|B1X7H3|MDTD_ECODH Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / DH10B) GN=mdtD PE=3 SV=1 111 450 4.0E-08
sp|C4ZSG5|MDTD_ECOBW Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtD PE=3 SV=1 111 450 4.0E-08
sp|B7NQA9|MDTD_ECO7I Putative multidrug resistance protein MdtD OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtD PE=3 SV=1 111 450 4.0E-08
sp|B7L9V0|MDTD_ECO55 Putative multidrug resistance protein MdtD OS=Escherichia coli (strain 55989 / EAEC) GN=mdtD PE=3 SV=1 111 450 4.0E-08
sp|Q0TG13|MDTD_ECOL5 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtD PE=3 SV=1 111 450 4.0E-08
sp|Q83QZ0|MDTD_SHIFL Putative multidrug resistance protein MdtD OS=Shigella flexneri GN=mdtD PE=3 SV=1 111 450 4.0E-08
sp|B1LNW4|MDTD_ECOSM Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtD PE=3 SV=1 111 450 4.0E-08
sp|B7NCB3|MDTD_ECOLU Putative multidrug resistance protein MdtD OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtD PE=3 SV=1 111 450 4.0E-08
sp|B6HYS2|MDTD_ECOSE Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SE11) GN=mdtD PE=3 SV=1 111 450 5.0E-08
sp|B7M460|MDTD_ECO8A Putative multidrug resistance protein MdtD OS=Escherichia coli O8 (strain IAI1) GN=mdtD PE=3 SV=1 111 450 5.0E-08
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 147 271 7.0E-08
sp|Q9H2V7|SPNS1_HUMAN Protein spinster homolog 1 OS=Homo sapiens GN=SPNS1 PE=1 SV=1 54 258 1.0E-07
sp|Q0T353|MDTD_SHIF8 Putative multidrug resistance protein MdtD OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtD PE=3 SV=2 111 450 1.0E-07
sp|A7ZNQ0|MDTD_ECO24 Putative multidrug resistance protein MdtD OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtD PE=3 SV=1 111 450 1.0E-07
sp|Q323D8|MDTD_SHIBS Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtD PE=3 SV=1 111 450 2.0E-07
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 96 511 2.0E-07
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 145 257 6.0E-07
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 147 292 9.0E-07
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 100 288 1.0E-06
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 133 510 2.0E-06
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 133 510 2.0E-06
sp|B0JZE1|SPNS2_XENTR Protein spinster homolog 2 OS=Xenopus tropicalis GN=spns2 PE=2 SV=1 106 360 4.0E-06
sp|Q08DX7|SPNS1_BOVIN Protein spinster homolog 1 OS=Bos taurus GN=SPNS1 PE=2 SV=1 54 258 4.0E-06
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 138 255 4.0E-06
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 37 255 5.0E-06
sp|Q91VM4|SPNS2_MOUSE Protein spinster homolog 2 OS=Mus musculus GN=Spns2 PE=2 SV=2 106 273 5.0E-06
sp|Q8IVW8|SPNS2_HUMAN Protein spinster homolog 2 OS=Homo sapiens GN=SPNS2 PE=1 SV=2 106 273 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 96 118 22
2 133 155 22
3 162 184 22
4 188 210 22
5 223 243 20
6 253 275 22
7 288 310 22
8 320 339 19
9 358 380 22
10 398 420 22
11 427 444 17
12 454 473 19
13 493 515 22
14 561 583 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1239
MGQDPSGLRVLVNSHKGCNLSPIDQGARKEGPRIGAGIMEKQANAAAGPLVTDDDSPRRSSSTTPNASVDVPPAT
DKAAAHQFNEQTNYVPKRTIITIFLACASVDLLALMDQTTLAASLYIIGNALGSTNQVSWIASGYFITSTVGQLL
YGRLSDIWSRKVVLLVGLAIFFIGSLASSLAQSVLQLTIFRAFTGVGGGGLMTVAQLIVSDVVPLRERGKYQGIL
GAVVAIANGIGPVVGGALSSQSRDSWRWIFRLNLPLTALTTGCVIFFMPLKKVQGDWKLKLKAVDFMGILLAFAG
MTVVILGLTWGGREYAWNSAHVIATLAVGSAVSAAFVLWQWKGPRYPLVPLHIFKSKIVNGACLTMAINGWNFVM
QVYYVPSFYQLVYGYSATKSGAMLLPITILQTVSSTLSGLVVHWIGRYRECILFGWVCWAVGLGLMSTLDESTGV
DKQIGYAILIGIGVGNTLQPALIATQAGVERRDMAVVTSFRNFVRNLGSTLGLAVSGTIINNILAHDLASLGLDS
SESKTLLSNPQTFLASVSPEEAERVRGILIPAYRQGFRLIFIVGASLAALAFVLAFVLMPQVELSRPDDAKLKEE
GRKAEEEKRQKKSSA*
Coding >Hirsu2|1239
ATGGGACAGGATCCATCCGGACTGCGGGTTTTGGTTAACAGCCACAAAGGTTGTAACTTGTCTCCAATCGACCAA
GGCGCGCGCAAGGAAGGACCGCGCATCGGGGCCGGCATCATGGAAAAGCAGGCCAACGCGGCCGCGGGCCCGCTC
GTGACCGACGACGACAGCCCGCGGCGCAGCTCGAGCACGACGCCCAACGCCAGCGTCGACGTGCCGCCGGCCACG
GACAAGGCTGCGGCGCACCAGTTCAACGAGCAGACCAACTATGTGCCCAAGCGGACAATCATCACCATCTTCCTG
GCCTGCGCAAGTGTCGACTTGCTGGCGCTCATGGACCAGACGACGCTCGCTGCCAGCCTGTACATCATCGGAAAT
GCGCTGGGGTCGACCAACCAGGTTTCGTGGATCGCCAGCGGATACTTCATCACGTCCACCGTCGGCCAGCTTCTC
TACGGGCGCCTTTCGGATATTTGGTCGCGCAAGGTCGTCTTGCTCGTCGGGCTCGCCATCTTCTTCATCGGCTCT
TTGGCCTCCTCTCTCGCCCAGTCCGTGCTGCAGCTCACCATCTTCCGCGCATTCACCGGCGTCGGCGGCGGCGGC
TTGATGACTGTCGCCCAGCTCATCGTTAGCGACGTCGTGCCGCTGCGAGAACGGGGCAAATATCAGGGCATTCTG
GGCGCAGTTGTCGCGATTGCCAATGGCATCGGCCCCGTCGTCGGAGGTGCCCTCTCCTCCCAATCTCGCGACTCT
TGGCGCTGGATCTTCCGCCTGAATCTGCCCTTGACCGCTCTGACGACCGGATGCGTCATCTTCTTCATGCCATTG
AAAAAGGTTCAGGGGGACTGGAAGCTGAAGCTCAAGGCGGTCGACTTCATGGGCATCTTGCTCGCCTTCGCCGGC
ATGACAGTCGTGATTCTGGGCTTGACATGGGGAGGGCGCGAGTATGCGTGGAACTCGGCTCATGTCATTGCCACT
TTGGCCGTCGGATCGGCCGTGTCGGCTGCTTTTGTCCTGTGGCAATGGAAAGGGCCGAGATATCCGCTGGTGCCT
CTTCACATCTTCAAGTCCAAGATCGTCAACGGCGCGTGCCTGACCATGGCCATCAACGGATGGAACTTCGTCATG
CAGGTCTATTACGTCCCGTCCTTCTACCAGCTCGTGTACGGCTACTCGGCCACCAAATCGGGGGCTATGCTACTG
CCCATCACGATTCTGCAGACGGTCAGCAGCACGCTGTCGGGGCTGGTCGTCCACTGGATCGGCCGCTACCGCGAG
TGCATCCTGTTCGGGTGGGTATGCTGGGCAGTGGGCCTGGGCCTGATGTCGACGCTCGACGAGTCGACGGGCGTT
GATAAGCAGATCGGCTACGCCATCCTCATTGGAATAGGCGTCGGCAATACGCTGCAGCCCGCACTGATTGCAACG
CAGGCAGGGGTCGAGAGACGCGACATGGCCGTTGTTACGTCGTTTAGGAACTTCGTGCGAAACCTCGGATCCACG
CTCGGGCTGGCCGTCTCCGGAACCATCATAAACAACATCCTCGCCCACGACCTGGCGTCCCTAGGCCTGGACAGT
TCAGAGTCCAAGACGCTGCTGAGCAACCCGCAGACGTTCCTCGCCAGCGTGTCGCCCGAGGAGGCCGAGCGGGTC
CGAGGCATTCTCATCCCGGCGTACCGGCAGGGCTTCCGCCTCATCTTCATCGTGGGCGCGTCGCTGGCCGCGCTG
GCCTTTGTGCTGGCCTTTGTGCTGATGCCCCAGGTCGAGCTGTCGCGGCCCGACGATGCCAAGCTGAAGGAAGAA
GGGCGCAAGGCTGAGGAGGAGAAGCGACAAAAGAAGAGTTCGGCCTAG
Transcript >Hirsu2|1239
ATGGGACAGGATCCATCCGGACTGCGGGTTTTGGTTAACAGCCACAAAGGTTGTAACTTGTCTCCAATCGACCAA
GGCGCGCGCAAGGAAGGACCGCGCATCGGGGCCGGCATCATGGAAAAGCAGGCCAACGCGGCCGCGGGCCCGCTC
GTGACCGACGACGACAGCCCGCGGCGCAGCTCGAGCACGACGCCCAACGCCAGCGTCGACGTGCCGCCGGCCACG
GACAAGGCTGCGGCGCACCAGTTCAACGAGCAGACCAACTATGTGCCCAAGCGGACAATCATCACCATCTTCCTG
GCCTGCGCAAGTGTCGACTTGCTGGCGCTCATGGACCAGACGACGCTCGCTGCCAGCCTGTACATCATCGGAAAT
GCGCTGGGGTCGACCAACCAGGTTTCGTGGATCGCCAGCGGATACTTCATCACGTCCACCGTCGGCCAGCTTCTC
TACGGGCGCCTTTCGGATATTTGGTCGCGCAAGGTCGTCTTGCTCGTCGGGCTCGCCATCTTCTTCATCGGCTCT
TTGGCCTCCTCTCTCGCCCAGTCCGTGCTGCAGCTCACCATCTTCCGCGCATTCACCGGCGTCGGCGGCGGCGGC
TTGATGACTGTCGCCCAGCTCATCGTTAGCGACGTCGTGCCGCTGCGAGAACGGGGCAAATATCAGGGCATTCTG
GGCGCAGTTGTCGCGATTGCCAATGGCATCGGCCCCGTCGTCGGAGGTGCCCTCTCCTCCCAATCTCGCGACTCT
TGGCGCTGGATCTTCCGCCTGAATCTGCCCTTGACCGCTCTGACGACCGGATGCGTCATCTTCTTCATGCCATTG
AAAAAGGTTCAGGGGGACTGGAAGCTGAAGCTCAAGGCGGTCGACTTCATGGGCATCTTGCTCGCCTTCGCCGGC
ATGACAGTCGTGATTCTGGGCTTGACATGGGGAGGGCGCGAGTATGCGTGGAACTCGGCTCATGTCATTGCCACT
TTGGCCGTCGGATCGGCCGTGTCGGCTGCTTTTGTCCTGTGGCAATGGAAAGGGCCGAGATATCCGCTGGTGCCT
CTTCACATCTTCAAGTCCAAGATCGTCAACGGCGCGTGCCTGACCATGGCCATCAACGGATGGAACTTCGTCATG
CAGGTCTATTACGTCCCGTCCTTCTACCAGCTCGTGTACGGCTACTCGGCCACCAAATCGGGGGCTATGCTACTG
CCCATCACGATTCTGCAGACGGTCAGCAGCACGCTGTCGGGGCTGGTCGTCCACTGGATCGGCCGCTACCGCGAG
TGCATCCTGTTCGGGTGGGTATGCTGGGCAGTGGGCCTGGGCCTGATGTCGACGCTCGACGAGTCGACGGGCGTT
GATAAGCAGATCGGCTACGCCATCCTCATTGGAATAGGCGTCGGCAATACGCTGCAGCCCGCACTGATTGCAACG
CAGGCAGGGGTCGAGAGACGCGACATGGCCGTTGTTACGTCGTTTAGGAACTTCGTGCGAAACCTCGGATCCACG
CTCGGGCTGGCCGTCTCCGGAACCATCATAAACAACATCCTCGCCCACGACCTGGCGTCCCTAGGCCTGGACAGT
TCAGAGTCCAAGACGCTGCTGAGCAACCCGCAGACGTTCCTCGCCAGCGTGTCGCCCGAGGAGGCCGAGCGGGTC
CGAGGCATTCTCATCCCGGCGTACCGGCAGGGCTTCCGCCTCATCTTCATCGTGGGCGCGTCGCTGGCCGCGCTG
GCCTTTGTGCTGGCCTTTGTGCTGATGCCCCAGGTCGAGCTGTCGCGGCCCGACGATGCCAAGCTGAAGGAAGAA
GGGCGCAAGGCTGAGGAGGAGAAGCGACAAAAGAAGAGTTCGGCCTAG
Gene >Hirsu2|1239
ATGGGACAGGATCCATCCGGACTGCGGGTTTTGGTTAACAGCCACAAAGGTTGTAACTTGTAAGTGAGGCCAGGC
GGCACCCGACTCCTCCAAGCTCGACTCCTTCGGGCTCGACGCCTCCCCCTTCCCTCTCCTGGAGCCCCCCCCTTT
CGTCGTCACGACGGTCATGGCCGCGTCGATTGCCTGCTGCTGCTGACCTGCCTGTGAGGTCTCCAATCGACCAAG
GCGCGCGCAAGGAAGGACCGCGCATCGGGGCCGGCATCATGGAAAAGCAGGCCAACGCGGCCGCGGGCCCGCTCG
TGACCGACGACGACAGCCCGCGGCGCAGCTCGAGCACGACGCCCAACGCCAGCGTCGACGTGCCGCCGGCCACGG
ACAAGGCTGCGGCGCACCAGTTCAACGAGCAGACCAACTATGTGCCCAAGCGGACAATCATCACCGTGAGCGGCC
ACGCCGCCCTGCCCCTTGCGAGCGACTGCGCTGACGGCCTCCATCTCCGGGTCAGATCTTCCTGGCCTGCGCAAG
TGTCGACTTGCTGGCGCTCATGGACCAGACGACGCTCGCTGCCAGCCTGTACATCATCGGAAATGCGCTGGGGTC
GACCAACCAGGTTTCGTGGATCGCCAGCGGATACTTCATGTGAGTCGGTCGGCGCAGGCTCGAGAGCTTGGTTGA
CGCGCGCCCACAGCACGTCCACCGTCGGCCAGCTTCTCTACGGGCGCCTTTCGGATATTTGGTCGCGCAAGGTCG
TCTTGCTCGTCGGGCTCGCCATCTTCTTCATCGGCTCTTTGGCCTCCTCTCTCGCCCAGTCCGTGCTGCAGCTCA
CCATCTTCCGCGCATTCACCGGCGTCGGCGGCGGCGGCTTGATGACTGTCGCCCAGCTCATCGTTAGCGACGTCG
TGCCGCTGCGAGAACGGGGCAAATATCAGGGCATTCTGGTAGGCCTCACGCAAGCCTCTCGCAGCCGCGAACCCT
CTCTCGGATGCGACTGCCGCTGACTCGTCTTCCTCGCCCTCTCCGTGCCCTCCGTCCTGGTTTAGGGCGCAGTTG
TCGCGATTGCCAATGGCATCGGCCCCGTCGTCGGAGGTGCCCTCTCCTCCCAATCTCGCGACTCTTGGCGCTGGA
TCTTCCGCCTGAATCTGCCCTTGACCGCTCTGACGACCGGATGCGTCATCTTCTTCATGCCATTGAAAAAGGTTC
AGGGGGACTGGAAGCTGTAGGCTGCCGCCTTGACCCCACACCCAATACTCCCCTCATTCCGGGACGAGACGAAGC
GGCGGAAGCCAGGGCGAGGCGCGTGCTGACCGACAGGCAGGAAGCTCAAGGCGGTCGACTTCATGGGCATCTTGC
TCGCCTTCGCCGGCATGACAGTCGTGATTCTGGGCTTGACATGGGGAGGGCGCGAGTATGCGTGGAACTCGGCTC
ATGTCATTGCCACTTTGGCCGTCGGATCGGCCGTGTCGGCTGCTTTTGTCCTGTGGCAATGGAAAGGGCCGAGAT
ATCCGCTGGTGCCTCGTATGGTCGTCCAACTGCGCCATCGGAATCCGAGGCCCCTGGCTGACGTGCTCAGTTCAC
ATCTTCAAGTCCAAGATCGTCAACGGCGCGTGCCTGACCATGGCCATCAACGGATGGAACTTCGTCATGCAGGTC
TATTACGTCCCGTCCTTCTACCAGCTCGTGTACGGCTACTCGGCCACCAAATCGGGGGCTATGCTACTGCCCATC
ACGATTCTGCAGACGGTCAGCAGCACGCTGTCGGGGCTGGTCGTCCACTGGATCGGCCGCTACCGCGAGTGCATC
CTGTTCGGGTGGGTATGCTGGGCAGTGGGCCTGGGCCTGATGTCGACGCTCGACGAGTCGACGGGCGTTGATAAG
CAGATCGGCTACGCCATCCTCATTGGAATAGGCGTCGGCAATACGCTGCAGCCGTGAGCATCGCCAGCCTTCCCC
TCCCGGTCCTTGTGCCCCGTTGGCTGACGGCACGAAGCGCACTGATTGCAACGCAGGCAGGGGTCGAGAGACGCG
ACATGGCCGTTGTTACGTCGTTTAGGAAGTATGTCACCTCCGGCGGTCTTCCTTTGTGGATCATGGGGGTGGCGT
GATGAACTGACGGGCGTTGTGACAAGCTTCGTGCGAAACCTCGGATCCACGCTCGGGCTGGCCGTCTCCGGAACC
ATCATGTGAGCATCACGAGCAAGGCGTGAGGGGGAGAATCGCTGGAGACGGGGCAAGGCTGACGGTCGAGCAACG
CAGAAACAACATCCTCGCCCACGACCTGGCGTCCCTAGGCCTGGACAGTTCAGAGTCCAAGACGCTGCTGAGCAA
CCCGCAGACGTTCCTCGCCAGCGTGTCGCCCGAGGAGGCCGAGCGGGTCCGAGGCATTCTCATCCCGGCGTACCG
GCAGGGCTTCCGCCTCATCTTCATCGTGGGCGCGTCGCTGGCCGCGCTGGCCTTTGTGCTGGCCTTTGTGCTGAT
GCCCCAGGTCGAGCTGTCGCGGCCCGACGATGCCAAGCTGAAGGAAGAAGGGCGCAAGGCTGAGGAGGAGAAGCG
ACAAAAGAAGAGTTCGGCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail