Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1225
Gene name
LocationContig_1264:3602..6793
Strand+
Gene length (bp)3191
Transcript length (bp)3024
Coding sequence length (bp)3024
Protein length (aa) 1008

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 2.0E-18 38 114
PF01822 WSC WSC domain 1.8E-18 141 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 58 237 5.0E-23
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 37 233 1.0E-20
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 54 229 1.0E-20
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 38 229 3.0E-17
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 38 234 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 58 237 5.0E-23
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 37 233 1.0E-20
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 54 229 1.0E-20
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 38 229 3.0E-17
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 38 234 2.0E-16
sp|O88799|ZAN_MOUSE Zonadhesin OS=Mus musculus GN=Zan PE=1 SV=1 314 603 1.0E-15
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 38 229 4.0E-15
sp|O88799|ZAN_MOUSE Zonadhesin OS=Mus musculus GN=Zan PE=1 SV=1 340 596 3.0E-14
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 247 652 4.0E-13
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 38 229 5.0E-13
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 122 235 6.0E-13
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 136 266 2.0E-12
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 139 229 3.0E-12
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 140 229 5.0E-11
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 46 122 5.0E-11
sp|O88799|ZAN_MOUSE Zonadhesin OS=Mus musculus GN=Zan PE=1 SV=1 319 589 1.0E-10
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 38 193 1.0E-10
sp|O88799|ZAN_MOUSE Zonadhesin OS=Mus musculus GN=Zan PE=1 SV=1 388 670 4.0E-10
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 127 229 8.0E-10
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 38 193 1.0E-09
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 127 229 1.0E-09
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 129 300 2.0E-09
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 140 229 5.0E-09
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 38 193 7.0E-09
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 38 193 8.0E-09
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 141 235 1.0E-08
sp|O88799|ZAN_MOUSE Zonadhesin OS=Mus musculus GN=Zan PE=1 SV=1 241 582 2.0E-08
sp|O88799|ZAN_MOUSE Zonadhesin OS=Mus musculus GN=Zan PE=1 SV=1 385 654 2.0E-07
sp|Q5QQ52|XYLT_CAEBR Xylosyltransferase sqv-6 OS=Caenorhabditis briggsae GN=sqv-6 PE=2 SV=1 131 263 3.0E-07
sp|O88799|ZAN_MOUSE Zonadhesin OS=Mus musculus GN=Zan PE=1 SV=1 396 685 3.0E-07
sp|O35930|GP1BA_MOUSE Platelet glycoprotein Ib alpha chain OS=Mus musculus GN=Gp1ba PE=1 SV=2 371 538 5.0E-07
sp|O35930|GP1BA_MOUSE Platelet glycoprotein Ib alpha chain OS=Mus musculus GN=Gp1ba PE=1 SV=2 324 533 1.0E-06
sp|O88799|ZAN_MOUSE Zonadhesin OS=Mus musculus GN=Zan PE=1 SV=1 314 532 2.0E-06
sp|Q9W4E2|NBEA_DROME Neurobeachin OS=Drosophila melanogaster GN=rg PE=1 SV=3 313 632 6.0E-06
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 35 122 9.0E-06
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 35 122 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1225
MRSALAAAAALALVPLTQAWNIELPPCLDEFKPFVKSGCFQDGNPQALIFRSSLDQRDMTVEKCVADCKGNGFRY
AGLKYYGVCFCGSTVNGPQVDDSQCSLPCSGNKTETCGGNNALSIWQDPTFSKGPKDVTVDDYKSLGCYTDESKK
GRTLSWPVKVDAATFTTKSCLAACEKEGFPFAGTEYGSECWCGVVLANDTAKVDDKQCNVPCKGGGSDKCGGPSR
LNLYVAKDLESLEPCGYHPGTTSSSPAVTTTATTPSYGLPDTTSSKAATTTPGSPSYGLPDTSTSKAATTTTPGS
PSYGLPGTSTTAVTTPGDETTTKTDVTTSQPGETTATTKPGETTTVPDVTTKTQPEDTTSVPYGTATVPDTTTQT
QPEETTTVPDTTTRTKPEETTTVPDTTTVPDTTTKTKPEETTTVPETTTVPDTTTKTKPEETTTIPDTTTVPDTT
TRTKPEETTTVPETTTVPDTTTKTKPEETTTVPETTTVPDTTTVPDTTTKTKPEETTTVPDVSTKTQPEETTTVP
DTTTMTQPEETTTTQPDYPTTKPGETTVTKPEETTTQAEQTTTKPQETSTSVQSSTTEAEQTTTKPQETSTSVQS
STTEAEQTTTKSYDTTTQTAGESTSTDIAGPSTTTKADESTTSESRDTTTVPEQGTTTSATQPIVTTPATTPTTT
TKGRVTSTKPALCTATSTVPSKCEWQRGNWCAPPLPDWHDRRGCLVAAKTCTLQVMSCFKYAGWPHTIDCFDFQK
WCSNVRQYCVTGCNSGKCGKGDCWDQHRPSYGKAPVTTTSVYPCPAATATDKPTTTAAPPATSCPPVPTNICTQP
TNGRWGYGPGKPVGGIPLPVVGCNDIKEDWQRNPYKLYTEPDSARCPSFQWPRRPDVCLDSCREQYQQCRNTYVD
SCQKLGWKKGFHKRRDGETEVEFSRRSQMWAGTVDPPPSGYGGRGACASSGNDYSWGGYGSDSVNCWGWGGNTPD
KADQRCRAQYQDCVAVNRNVNPGNQCQSFCHK*
Coding >Hirsu2|1225
ATGAGGTCTGCCCTGGCCGCTGCGGCGGCTCTGGCCCTCGTGCCGCTCACGCAGGCGTGGAACATCGAACTCCCT
CCCTGCCTCGACGAATTCAAGCCCTTCGTCAAGTCGGGCTGCTTCCAGGATGGCAATCCCCAGGCGTTGATCTTC
CGCTCCAGCCTGGACCAGAGGGACATGACGGTCGAGAAGTGCGTTGCTGACTGCAAAGGCAACGGCTTCCGCTAT
GCCGGTCTCAAGTACTACGGCGTTTGTTTCTGTGGCTCCACCGTCAACGGTCCGCAGGTCGACGACTCTCAGTGC
TCACTGCCCTGCAGCGGCAACAAGACCGAGACGTGTGGTGGCAACAACGCTCTCTCTATCTGGCAGGACCCTACC
TTCTCCAAGGGCCCCAAGGATGTCACCGTCGACGACTACAAGTCGCTGGGCTGCTACACCGACGAGTCCAAGAAG
GGCCGCACCCTTTCCTGGCCCGTCAAGGTGGATGCCGCTACCTTCACCACCAAGTCATGCTTGGCTGCTTGTGAA
AAGGAGGGCTTTCCCTTTGCTGGCACGGAATACGGAAGCGAGTGTTGGTGTGGCGTCGTTCTGGCCAACGACACA
GCCAAGGTCGACGACAAACAGTGCAACGTTCCGTGCAAGGGCGGCGGCTCCGACAAGTGCGGCGGCCCCTCGCGT
CTGAACCTCTACGTTGCCAAGGACCTCGAGTCTCTGGAGCCTTGTGGATACCATCCAGGCACGACGTCTTCGTCG
CCCGCCGTCACCACCACCGCGACAACTCCGTCGTACGGCCTTCCCGACACGACCTCCTCCAAGGCCGCCACCACC
ACCCCCGGGTCGCCGTCGTACGGCCTTCCCGACACCAGCACCTCCAAGGCCGCCACCACCACCACCCCCGGATCG
CCTTCGTACGGCCTTCCCGGCACCAGCACCACGGCCGTCACCACTCCCGGCGACGAGACGACCACCAAGACCGAC
GTCACGACGAGCCAGCCCGGGGAGACGACGGCGACGACCAAGCCTGGAGAGACCACCACCGTCCCCGACGTGACG
ACCAAGACGCAGCCCGAAGATACCACCAGCGTTCCTTACGGTACCGCGACCGTCCCCGACACGACTACCCAGACG
CAGCCCGAGGAGACGACGACCGTCCCGGACACGACCACGAGGACGAAGCCTGAGGAGACCACCACCGTCCCGGAC
ACGACGACCGTCCCCGACACAACCACTAAGACGAAGCCTGAGGAGACGACTACCGTCCCGGAGACGACGACCGTC
CCCGACACAACCACCAAGACGAAGCCCGAGGAGACCACCACTATCCCCGACACGACCACTGTCCCCGACACGACC
ACCCGGACGAAGCCTGAGGAGACCACCACCGTCCCGGAGACGACGACCGTCCCCGACACAACCACCAAGACGAAG
CCCGAGGAGACGACTACCGTCCCGGAGACGACGACCGTCCCCGACACGACCACTGTCCCCGACACAACCACCAAG
ACGAAGCCCGAGGAGACGACTACCGTTCCCGACGTGTCGACCAAGACGCAGCCCGAGGAGACGACGACCGTCCCC
GACACGACCACCATGACCCAGCCTGAGGAGACCACTACCACCCAGCCTGACTATCCGACGACGAAGCCGGGCGAG
ACCACCGTGACCAAGCCGGAAGAGACGACGACCCAGGCCGAACAGACAACCACCAAGCCCCAGGAGACCAGCACG
AGCGTCCAGTCGTCCACCACCGAGGCCGAGCAGACGACGACCAAGCCCCAAGAGACCAGCACAAGCGTCCAGTCG
TCCACCACCGAGGCCGAACAGACGACGACCAAGTCCTACGACACAACAACCCAGACGGCAGGGGAGTCCACGTCG
ACCGACATTGCTGGTCCGTCCACGACGACCAAGGCCGACGAGTCGACGACGAGCGAGTCGCGTGACACCACCACG
GTCCCCGAGCAGGGCACGACCACGTCGGCTACGCAGCCCATCGTGACGACTCCCGCCACGACGCCTACGACTACG
ACAAAGGGCCGGGTGACGTCGACCAAGCCCGCTCTCTGCACCGCCACCAGCACTGTGCCTTCCAAGTGCGAGTGG
CAGCGCGGCAACTGGTGTGCTCCTCCCCTGCCCGACTGGCACGACAGGCGCGGCTGTCTGGTGGCGGCCAAGACG
TGCACGCTCCAGGTCATGTCGTGCTTCAAGTACGCCGGCTGGCCCCATACGATCGACTGCTTCGACTTCCAGAAG
TGGTGCAGCAACGTCCGCCAGTACTGCGTGACCGGGTGCAACAGCGGCAAGTGCGGCAAGGGCGACTGCTGGGAC
CAGCACCGGCCCAGCTACGGCAAGGCTCCCGTCACGACCACGTCCGTCTATCCCTGCCCTGCCGCCACGGCGACG
GACAAGCCGACGACGACGGCGGCCCCGCCGGCGACGTCGTGCCCGCCCGTCCCGACCAACATCTGCACGCAGCCG
ACCAACGGCCGGTGGGGCTACGGCCCCGGAAAGCCCGTCGGCGGCATCCCGCTGCCGGTCGTGGGCTGCAACGAC
ATCAAGGAGGACTGGCAGCGCAACCCGTACAAGCTGTACACGGAGCCCGACAGCGCGAGGTGCCCCTCGTTCCAG
TGGCCCAGGCGGCCCGACGTGTGCCTCGACTCGTGCCGGGAACAGTACCAGCAGTGCCGCAACACGTACGTCGAC
AGCTGCCAGAAGCTGGGCTGGAAGAAGGGCTTCCACAAGCGCCGCGACGGCGAGACTGAGGTCGAGTTCTCGCGC
CGCTCGCAGATGTGGGCGGGCACCGTCGACCCGCCGCCCAGCGGCTACGGCGGCCGCGGCGCCTGCGCCTCGTCC
GGCAACGACTATTCGTGGGGCGGATACGGGTCCGACTCGGTCAACTGCTGGGGCTGGGGCGGCAACACGCCGGAC
AAGGCCGACCAGCGCTGCAGGGCCCAGTACCAGGACTGCGTGGCCGTCAACAGGAACGTCAACCCCGGCAACCAG
TGCCAGTCCTTTTGCCACAAGTAG
Transcript >Hirsu2|1225
ATGAGGTCTGCCCTGGCCGCTGCGGCGGCTCTGGCCCTCGTGCCGCTCACGCAGGCGTGGAACATCGAACTCCCT
CCCTGCCTCGACGAATTCAAGCCCTTCGTCAAGTCGGGCTGCTTCCAGGATGGCAATCCCCAGGCGTTGATCTTC
CGCTCCAGCCTGGACCAGAGGGACATGACGGTCGAGAAGTGCGTTGCTGACTGCAAAGGCAACGGCTTCCGCTAT
GCCGGTCTCAAGTACTACGGCGTTTGTTTCTGTGGCTCCACCGTCAACGGTCCGCAGGTCGACGACTCTCAGTGC
TCACTGCCCTGCAGCGGCAACAAGACCGAGACGTGTGGTGGCAACAACGCTCTCTCTATCTGGCAGGACCCTACC
TTCTCCAAGGGCCCCAAGGATGTCACCGTCGACGACTACAAGTCGCTGGGCTGCTACACCGACGAGTCCAAGAAG
GGCCGCACCCTTTCCTGGCCCGTCAAGGTGGATGCCGCTACCTTCACCACCAAGTCATGCTTGGCTGCTTGTGAA
AAGGAGGGCTTTCCCTTTGCTGGCACGGAATACGGAAGCGAGTGTTGGTGTGGCGTCGTTCTGGCCAACGACACA
GCCAAGGTCGACGACAAACAGTGCAACGTTCCGTGCAAGGGCGGCGGCTCCGACAAGTGCGGCGGCCCCTCGCGT
CTGAACCTCTACGTTGCCAAGGACCTCGAGTCTCTGGAGCCTTGTGGATACCATCCAGGCACGACGTCTTCGTCG
CCCGCCGTCACCACCACCGCGACAACTCCGTCGTACGGCCTTCCCGACACGACCTCCTCCAAGGCCGCCACCACC
ACCCCCGGGTCGCCGTCGTACGGCCTTCCCGACACCAGCACCTCCAAGGCCGCCACCACCACCACCCCCGGATCG
CCTTCGTACGGCCTTCCCGGCACCAGCACCACGGCCGTCACCACTCCCGGCGACGAGACGACCACCAAGACCGAC
GTCACGACGAGCCAGCCCGGGGAGACGACGGCGACGACCAAGCCTGGAGAGACCACCACCGTCCCCGACGTGACG
ACCAAGACGCAGCCCGAAGATACCACCAGCGTTCCTTACGGTACCGCGACCGTCCCCGACACGACTACCCAGACG
CAGCCCGAGGAGACGACGACCGTCCCGGACACGACCACGAGGACGAAGCCTGAGGAGACCACCACCGTCCCGGAC
ACGACGACCGTCCCCGACACAACCACTAAGACGAAGCCTGAGGAGACGACTACCGTCCCGGAGACGACGACCGTC
CCCGACACAACCACCAAGACGAAGCCCGAGGAGACCACCACTATCCCCGACACGACCACTGTCCCCGACACGACC
ACCCGGACGAAGCCTGAGGAGACCACCACCGTCCCGGAGACGACGACCGTCCCCGACACAACCACCAAGACGAAG
CCCGAGGAGACGACTACCGTCCCGGAGACGACGACCGTCCCCGACACGACCACTGTCCCCGACACAACCACCAAG
ACGAAGCCCGAGGAGACGACTACCGTTCCCGACGTGTCGACCAAGACGCAGCCCGAGGAGACGACGACCGTCCCC
GACACGACCACCATGACCCAGCCTGAGGAGACCACTACCACCCAGCCTGACTATCCGACGACGAAGCCGGGCGAG
ACCACCGTGACCAAGCCGGAAGAGACGACGACCCAGGCCGAACAGACAACCACCAAGCCCCAGGAGACCAGCACG
AGCGTCCAGTCGTCCACCACCGAGGCCGAGCAGACGACGACCAAGCCCCAAGAGACCAGCACAAGCGTCCAGTCG
TCCACCACCGAGGCCGAACAGACGACGACCAAGTCCTACGACACAACAACCCAGACGGCAGGGGAGTCCACGTCG
ACCGACATTGCTGGTCCGTCCACGACGACCAAGGCCGACGAGTCGACGACGAGCGAGTCGCGTGACACCACCACG
GTCCCCGAGCAGGGCACGACCACGTCGGCTACGCAGCCCATCGTGACGACTCCCGCCACGACGCCTACGACTACG
ACAAAGGGCCGGGTGACGTCGACCAAGCCCGCTCTCTGCACCGCCACCAGCACTGTGCCTTCCAAGTGCGAGTGG
CAGCGCGGCAACTGGTGTGCTCCTCCCCTGCCCGACTGGCACGACAGGCGCGGCTGTCTGGTGGCGGCCAAGACG
TGCACGCTCCAGGTCATGTCGTGCTTCAAGTACGCCGGCTGGCCCCATACGATCGACTGCTTCGACTTCCAGAAG
TGGTGCAGCAACGTCCGCCAGTACTGCGTGACCGGGTGCAACAGCGGCAAGTGCGGCAAGGGCGACTGCTGGGAC
CAGCACCGGCCCAGCTACGGCAAGGCTCCCGTCACGACCACGTCCGTCTATCCCTGCCCTGCCGCCACGGCGACG
GACAAGCCGACGACGACGGCGGCCCCGCCGGCGACGTCGTGCCCGCCCGTCCCGACCAACATCTGCACGCAGCCG
ACCAACGGCCGGTGGGGCTACGGCCCCGGAAAGCCCGTCGGCGGCATCCCGCTGCCGGTCGTGGGCTGCAACGAC
ATCAAGGAGGACTGGCAGCGCAACCCGTACAAGCTGTACACGGAGCCCGACAGCGCGAGGTGCCCCTCGTTCCAG
TGGCCCAGGCGGCCCGACGTGTGCCTCGACTCGTGCCGGGAACAGTACCAGCAGTGCCGCAACACGTACGTCGAC
AGCTGCCAGAAGCTGGGCTGGAAGAAGGGCTTCCACAAGCGCCGCGACGGCGAGACTGAGGTCGAGTTCTCGCGC
CGCTCGCAGATGTGGGCGGGCACCGTCGACCCGCCGCCCAGCGGCTACGGCGGCCGCGGCGCCTGCGCCTCGTCC
GGCAACGACTATTCGTGGGGCGGATACGGGTCCGACTCGGTCAACTGCTGGGGCTGGGGCGGCAACACGCCGGAC
AAGGCCGACCAGCGCTGCAGGGCCCAGTACCAGGACTGCGTGGCCGTCAACAGGAACGTCAACCCCGGCAACCAG
TGCCAGTCCTTTTGCCACAAGTAG
Gene >Hirsu2|1225
ATGAGGTCTGCCCTGGCCGCTGCGGCGGCTCTGGCCCTCGTGCCGCTCACGCAGGCGTGGAACATCGAACTCCCT
CCCTGCCTCGACGAATTCAAGCCCTTCGTCAAGTCGGGCTGCTTCCAGGATGGCAATCCCCAGGCGTTGATCTTC
CGCTCCAGCCTGGACCAGAGGGACATGACGGTCGAGAAGTGCGTTGCTGACTGCAAAGGTGCGTCCCTCGGTCCC
CGTAGCCTCCTCTGCCCCTTCCGCTGCTCACCTCTTCCGCAGGCAACGGCTTCCGCTATGCCGGTCTCAAGTACT
ACGGCGTTTGTTTCTGTGGCTCCACCGTCAACGGTCCGCAGGTCGACGACTCTCAGTGCTCACTGCCCTGCAGCG
GCAACAAGACCGAGACGTGTGGTGGCAACAACGCTCTCTCTATCTGGCAGGACCCTACCTTCTCCAAGGGCCCCA
AGGATGTCACCGTCGACGACTACAAGTCGCTGGGCTGCTACACCGACGAGTCCAAGAAGGGCCGCACCCTTTCCT
GGCCCGTCAAGGTGGATGCCGCTACCTTCACCACCAAGTCATGCTTGGCTGCTTGTGAAAAGGAGGGCTTTCCCT
TTGCTGGCACGGAATACGGAAGTGCGTTCTCCCCGCCCTCTGCCCTCCCCCCTTTCCCTCTCACTCTATCCCCAA
GAGTCGGAATTCCGGTCGAGTCAAACAACAAGAACTGACATGCGGTGCCGGTAGGCGAGTGTTGGTGTGGCGTCG
TTCTGGCCAACGACACAGCCAAGGTCGACGACAAACAGTGCAACGTTCCGTGCAAGGGCGGCGGCTCCGACAAGT
GCGGCGGCCCCTCGCGTCTGAACCTCTACGTTGCCAAGGACCTCGAGTCTCTGGAGCCTTGTGGATACCATCCAG
GCACGACGTCTTCGTCGCCCGCCGTCACCACCACCGCGACAACTCCGTCGTACGGCCTTCCCGACACGACCTCCT
CCAAGGCCGCCACCACCACCCCCGGGTCGCCGTCGTACGGCCTTCCCGACACCAGCACCTCCAAGGCCGCCACCA
CCACCACCCCCGGATCGCCTTCGTACGGCCTTCCCGGCACCAGCACCACGGCCGTCACCACTCCCGGCGACGAGA
CGACCACCAAGACCGACGTCACGACGAGCCAGCCCGGGGAGACGACGGCGACGACCAAGCCTGGAGAGACCACCA
CCGTCCCCGACGTGACGACCAAGACGCAGCCCGAAGATACCACCAGCGTTCCTTACGGTACCGCGACCGTCCCCG
ACACGACTACCCAGACGCAGCCCGAGGAGACGACGACCGTCCCGGACACGACCACGAGGACGAAGCCTGAGGAGA
CCACCACCGTCCCGGACACGACGACCGTCCCCGACACAACCACTAAGACGAAGCCTGAGGAGACGACTACCGTCC
CGGAGACGACGACCGTCCCCGACACAACCACCAAGACGAAGCCCGAGGAGACCACCACTATCCCCGACACGACCA
CTGTCCCCGACACGACCACCCGGACGAAGCCTGAGGAGACCACCACCGTCCCGGAGACGACGACCGTCCCCGACA
CAACCACCAAGACGAAGCCCGAGGAGACGACTACCGTCCCGGAGACGACGACCGTCCCCGACACGACCACTGTCC
CCGACACAACCACCAAGACGAAGCCCGAGGAGACGACTACCGTTCCCGACGTGTCGACCAAGACGCAGCCCGAGG
AGACGACGACCGTCCCCGACACGACCACCATGACCCAGCCTGAGGAGACCACTACCACCCAGCCTGACTATCCGA
CGACGAAGCCGGGCGAGACCACCGTGACCAAGCCGGAAGAGACGACGACCCAGGCCGAACAGACAACCACCAAGC
CCCAGGAGACCAGCACGAGCGTCCAGTCGTCCACCACCGAGGCCGAGCAGACGACGACCAAGCCCCAAGAGACCA
GCACAAGCGTCCAGTCGTCCACCACCGAGGCCGAACAGACGACGACCAAGTCCTACGACACAACAACCCAGACGG
CAGGGGAGTCCACGTCGACCGACATTGCTGGTCCGTCCACGACGACCAAGGCCGACGAGTCGACGACGAGCGAGT
CGCGTGACACCACCACGGTCCCCGAGCAGGGCACGACCACGTCGGCTACGCAGCCCATCGTGACGACTCCCGCCA
CGACGCCTACGACTACGACAAAGGGCCGGGTGACGTCGACCAAGCCCGCTCTCTGCACCGCCACCAGCACTGTGC
CTTCCAAGTGCGAGTGGCAGCGCGGCAACTGGTGTGCTCCTCCCCTGCCCGACTGGCACGACAGGCGCGGCTGTC
TGGTGGCGGCCAAGACGTGCACGCTCCAGGTCATGTCGTGCTTCAAGTACGCCGGCTGGCCCCATACGATCGACT
GCTTCGACTTCCAGAAGTGGTGCAGCAACGTCCGCCAGTACTGCGTGACCGGGTGCAACAGCGGCAAGTGCGGCA
AGGGCGACTGCTGGGACCAGCACCGGCCCAGCTACGGCAAGGCTCCCGTCACGACCACGTCCGTCTATCCCTGCC
CTGCCGCCACGGCGACGGACAAGCCGACGACGACGGCGGCCCCGCCGGCGACGTCGTGCCCGCCCGTCCCGACCA
ACATCTGCACGCAGCCGACCAACGGCCGGTGGGGCTACGGCCCCGGAAAGCCCGTCGGCGGCATCCCGCTGCCGG
TCGTGGGCTGCAACGACATCAAGGAGGACTGGCAGCGCAACCCGTACAAGCTGTACACGGAGCCCGACAGCGCGA
GGTGCCCCTCGTTCCAGTGGCCCAGGCGGCCCGACGTGTGCCTCGACTCGTGCCGGGAACAGTACCAGCAGTGCC
GCAACACGTACGTCGACAGCTGCCAGAAGCTGGGCTGGAAGAAGGGCTTCCACAAGCGCCGCGACGGCGAGACTG
AGGTCGAGTTCTCGCGCCGCTCGCAGATGTGGGCGGGCACCGTCGACCCGCCGCCCAGCGGCTACGGCGGCCGCG
GCGCCTGCGCCTCGTCCGGCAACGACTATTCGTGGGGCGGATACGGGTCCGACTCGGTCAACTGCTGGGGCTGGG
GCGGCAACACGCCGGACAAGGCCGACCAGCGCTGCAGGGCCCAGTACCAGGACTGCGTGGCCGTCAACAGGAACG
TCAACCCCGGCAACCAGTGCCAGTCCTTTTGCCACAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail