Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1221
Gene name
LocationContig_1262:6735..7691
Strand+
Gene length (bp)956
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01467 CTP_transf_like Cytidylyltransferase-like 1.8E-30 152 280

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P13259|PCY1_YEAST Choline-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCT1 PE=1 SV=2 66 280 3.0E-68
sp|O74975|PCY1_SCHPO Probable choline-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.02c PE=1 SV=3 137 280 6.0E-67
sp|Q9QZC4|PCY1B_RAT Choline-phosphate cytidylyltransferase B OS=Rattus norvegicus GN=Pcyt1b PE=1 SV=1 144 280 1.0E-57
sp|Q811Q9|PCY1B_MOUSE Choline-phosphate cytidylyltransferase B OS=Mus musculus GN=Pcyt1b PE=1 SV=2 144 280 1.0E-57
sp|Q9Y5K3|PCY1B_HUMAN Choline-phosphate cytidylyltransferase B OS=Homo sapiens GN=PCYT1B PE=1 SV=1 118 280 2.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P13259|PCY1_YEAST Choline-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCT1 PE=1 SV=2 66 280 3.0E-68
sp|O74975|PCY1_SCHPO Probable choline-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.02c PE=1 SV=3 137 280 6.0E-67
sp|Q9QZC4|PCY1B_RAT Choline-phosphate cytidylyltransferase B OS=Rattus norvegicus GN=Pcyt1b PE=1 SV=1 144 280 1.0E-57
sp|Q811Q9|PCY1B_MOUSE Choline-phosphate cytidylyltransferase B OS=Mus musculus GN=Pcyt1b PE=1 SV=2 144 280 1.0E-57
sp|Q9Y5K3|PCY1B_HUMAN Choline-phosphate cytidylyltransferase B OS=Homo sapiens GN=PCYT1B PE=1 SV=1 118 280 2.0E-57
sp|Q9ZV56|CCT1_ARATH Choline-phosphate cytidylyltransferase 1 OS=Arabidopsis thaliana GN=CCT1 PE=1 SV=1 141 280 7.0E-57
sp|F4JJE0|CCT2_ARATH Choline-phosphate cytidylyltransferase 2 OS=Arabidopsis thaliana GN=CCT2 PE=1 SV=1 147 280 2.0E-56
sp|P49585|PCY1A_HUMAN Choline-phosphate cytidylyltransferase A OS=Homo sapiens GN=PCYT1A PE=1 SV=2 144 280 1.0E-54
sp|P19836|PCY1A_RAT Choline-phosphate cytidylyltransferase A OS=Rattus norvegicus GN=Pcyt1a PE=1 SV=2 144 280 2.0E-54
sp|P49586|PCY1A_MOUSE Choline-phosphate cytidylyltransferase A OS=Mus musculus GN=Pcyt1a PE=1 SV=1 144 280 4.0E-54
sp|P49584|PCY1A_CRIGR Choline-phosphate cytidylyltransferase A OS=Cricetulus griseus GN=PCYT1A PE=2 SV=1 144 280 4.0E-53
sp|P49587|PCY1_PLAFK Choline-phosphate cytidylyltransferase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CTP PE=2 SV=1 146 280 3.0E-52
sp|P49583|PCY1_CAEEL Putative choline-phosphate cytidylyltransferase OS=Caenorhabditis elegans GN=F08C6.2 PE=3 SV=2 146 280 2.0E-47
sp|Q55BZ4|PCY2_DICDI Ethanolamine-phosphate cytidylyltransferase OS=Dictyostelium discoideum GN=pctA PE=1 SV=1 139 280 4.0E-31
sp|Q9ZVI9|PECT1_ARATH Ethanolamine-phosphate cytidylyltransferase OS=Arabidopsis thaliana GN=PECT1 PE=1 SV=1 147 280 6.0E-25
sp|Q5EA75|PCY2_BOVIN Ethanolamine-phosphate cytidylyltransferase OS=Bos taurus GN=PCYT2 PE=2 SV=1 135 280 4.0E-24
sp|Q99447|PCY2_HUMAN Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens GN=PCYT2 PE=1 SV=1 135 280 6.0E-24
sp|Q922E4|PCY2_MOUSE Ethanolamine-phosphate cytidylyltransferase OS=Mus musculus GN=Pcyt2 PE=1 SV=1 147 280 1.0E-23
sp|O88637|PCY2_RAT Ethanolamine-phosphate cytidylyltransferase OS=Rattus norvegicus GN=Pcyt2 PE=1 SV=1 147 280 2.0E-23
sp|P33412|ECT1_YEAST Ethanolamine-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECT1 PE=1 SV=1 148 280 1.0E-22
sp|Q9UTI6|ECT1_SCHPO Probable ethanolamine-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC15E1.05c PE=2 SV=1 150 280 3.0E-22
sp|Q8SQW6|ECT1_ENCCU Probable ethanolamine-phosphate cytidylyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=MUQ1 PE=1 SV=1 150 280 2.0E-18
sp|Q55BZ4|PCY2_DICDI Ethanolamine-phosphate cytidylyltransferase OS=Dictyostelium discoideum GN=pctA PE=1 SV=1 151 280 9.0E-17
sp|Q922E4|PCY2_MOUSE Ethanolamine-phosphate cytidylyltransferase OS=Mus musculus GN=Pcyt2 PE=1 SV=1 138 280 9.0E-13
sp|O88637|PCY2_RAT Ethanolamine-phosphate cytidylyltransferase OS=Rattus norvegicus GN=Pcyt2 PE=1 SV=1 151 280 4.0E-12
sp|Q99447|PCY2_HUMAN Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens GN=PCYT2 PE=1 SV=1 138 280 6.0E-12
sp|Q5EA75|PCY2_BOVIN Ethanolamine-phosphate cytidylyltransferase OS=Bos taurus GN=PCYT2 PE=2 SV=1 138 280 2.0E-11
sp|Q9ZVI9|PECT1_ARATH Ethanolamine-phosphate cytidylyltransferase OS=Arabidopsis thaliana GN=PECT1 PE=1 SV=1 151 280 2.0E-10
sp|Q8SQW6|ECT1_ENCCU Probable ethanolamine-phosphate cytidylyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=MUQ1 PE=1 SV=1 143 239 6.0E-09
sp|P33412|ECT1_YEAST Ethanolamine-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECT1 PE=1 SV=1 151 220 7.0E-08
sp|C5A1S7|RIBL_THEGJ FAD synthase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=ribL PE=3 SV=1 140 217 8.0E-08
sp|C6A439|RIBL_THESM FAD synthase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=ribL PE=3 SV=1 147 239 1.0E-07
sp|Q9UZ37|RIBL_PYRAB FAD synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ribL PE=3 SV=1 147 239 2.0E-07
sp|O58466|RIBL_PYRHO FAD synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ribL PE=3 SV=1 147 239 4.0E-06
sp|B6YXC8|RIBL_THEON FAD synthase OS=Thermococcus onnurineus (strain NA1) GN=ribL PE=3 SV=1 147 239 6.0E-06
sp|P27623|TAGD_BACSU Glycerol-3-phosphate cytidylyltransferase OS=Bacillus subtilis (strain 168) GN=tagD PE=1 SV=1 150 277 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0003824 catalytic activity Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1221
MPSPSSSSQGGKRKRAAAGLVSPPDPVDGAQQASSRDASGEEGDTTAPESGRHHRRNSNGAAPNPKRQRASADRN
ADAADHALDPGEPSDTTEASVDIAERVGRKGRKLTLKDCDDLDKTDAMPPPPIGKLTHPAGGFTTNSPPVGRPVR
VYADGVFDLFHLGHMRQLEQAKKAFPNTTLVVGVTGDDETHRRKGLTVLSASERAETVRHCKWVDEVIEDCPWIV
TPEFLDANRLDYVAHDDLPYGAAEGDDIYQPIKATGKFLVTQRTEGVSTTGIITR*
Coding >Hirsu2|1221
ATGCCCTCGCCGTCCAGCTCGTCCCAGGGCGGCAAGCGCAAGAGGGCGGCCGCCGGCCTCGTCTCGCCCCCGGAC
CCGGTCGACGGCGCGCAGCAGGCGTCGTCCCGCGATGCGTCGGGCGAAGAGGGCGACACCACGGCGCCCGAGTCC
GGCCGCCATCACCGGCGGAACTCGAACGGCGCGGCGCCGAATCCTAAGCGACAGCGGGCCAGCGCGGATCGAAAT
GCCGACGCCGCCGACCACGCCCTCGACCCGGGCGAGCCGAGCGACACGACCGAGGCCAGCGTCGACATCGCCGAA
CGCGTCGGCCGCAAGGGGCGCAAGCTCACCCTCAAGGACTGCGACGATCTTGACAAGACGGATGCCATGCCGCCG
CCACCCATCGGCAAGCTGACCCACCCGGCCGGCGGCTTCACGACGAACTCGCCCCCCGTCGGCCGTCCGGTGAGG
GTCTATGCCGATGGTGTTTTCGACCTGTTCCATCTCGGACATATGCGCCAGCTCGAGCAGGCCAAAAAGGCCTTC
CCCAACACGACGCTCGTCGTCGGCGTCACGGGCGACGACGAGACGCACCGGCGCAAGGGCCTGACCGTCCTGTCC
GCCAGCGAGCGTGCCGAGACGGTCCGACACTGCAAGTGGGTGGACGAAGTCATCGAGGACTGCCCGTGGATTGTC
ACGCCCGAATTCCTCGACGCCAATCGGCTCGATTACGTGGCCCACGACGACCTCCCGTACGGCGCCGCCGAGGGC
GACGACATTTACCAGCCCATCAAGGCGACCGGCAAGTTCCTCGTCACGCAGCGGACAGAAGGCGTCAGCACGACC
GGCATCATCACAAGGTGA
Transcript >Hirsu2|1221
ATGCCCTCGCCGTCCAGCTCGTCCCAGGGCGGCAAGCGCAAGAGGGCGGCCGCCGGCCTCGTCTCGCCCCCGGAC
CCGGTCGACGGCGCGCAGCAGGCGTCGTCCCGCGATGCGTCGGGCGAAGAGGGCGACACCACGGCGCCCGAGTCC
GGCCGCCATCACCGGCGGAACTCGAACGGCGCGGCGCCGAATCCTAAGCGACAGCGGGCCAGCGCGGATCGAAAT
GCCGACGCCGCCGACCACGCCCTCGACCCGGGCGAGCCGAGCGACACGACCGAGGCCAGCGTCGACATCGCCGAA
CGCGTCGGCCGCAAGGGGCGCAAGCTCACCCTCAAGGACTGCGACGATCTTGACAAGACGGATGCCATGCCGCCG
CCACCCATCGGCAAGCTGACCCACCCGGCCGGCGGCTTCACGACGAACTCGCCCCCCGTCGGCCGTCCGGTGAGG
GTCTATGCCGATGGTGTTTTCGACCTGTTCCATCTCGGACATATGCGCCAGCTCGAGCAGGCCAAAAAGGCCTTC
CCCAACACGACGCTCGTCGTCGGCGTCACGGGCGACGACGAGACGCACCGGCGCAAGGGCCTGACCGTCCTGTCC
GCCAGCGAGCGTGCCGAGACGGTCCGACACTGCAAGTGGGTGGACGAAGTCATCGAGGACTGCCCGTGGATTGTC
ACGCCCGAATTCCTCGACGCCAATCGGCTCGATTACGTGGCCCACGACGACCTCCCGTACGGCGCCGCCGAGGGC
GACGACATTTACCAGCCCATCAAGGCGACCGGCAAGTTCCTCGTCACGCAGCGGACAGAAGGCGTCAGCACGACC
GGCATCATCACAAGGTGA
Gene >Hirsu2|1221
ATGCCCTCGCCGTCCAGCTCGTCCCAGGGCGGCAAGCGCAAGAGGGCGGCCGCCGGCCTCGTCTCGCCCCCGGAC
CCGGTCGACGGCGCGCAGCAGGCGTCGTCCCGCGATGCGTCGGGCGAAGAGGGCGACACCACGGCGCCCGAGTCC
GGCCGCCATCACCGGCGGAACTCGAACGGCGCGGCGCCGAATCCTAAGCGACAGCGGGCCAGCGCGGATCGAAAT
GCCGACGCCGCCGACCACGCCCTCGACCCGGGCGAGCCGAGCGACACGACCGAGGCCAGCGTCGACATCGCCGAA
CGCGTCGGCCGCAAGGGGCGCAAGCTCACCCTCAAGGACTGCGACGATCTTGACAAGACGGATGCCATGCCGCCG
CCACCCATCGGCAAGCTGACCCACCCGGCCGGCGGCTTCACGACGAACTCGCCCCCCGTCGGCCGTCCGGTGAGG
GTCTATGCCGATGGTGTTTTCGACCTGTTCCATCTCGGGTCAGTCCTCCCTGTCTCTCTTCTTTTTTTTCCCTAC
CTTTTTTCCAGCACGCACGCATGGGCCCGCGTTGCCGGATCTGTAGAGGACAACGGGACGGCTGACGCGCCGGCA
GACATATGCGCCAGCTCGAGCAGGCCAAAAAGGCCTTCCCCAACACGACGCTCGTCGTCGGCGTCACGGGCGACG
ACGAGACGCACCGGCGCAAGGGCCTGACCGTCCTGTCCGCCAGCGAGCGTGCCGAGACGGTCCGACACTGCAAGT
GGGTGGACGAAGTCATCGAGGACTGCCCGTGGATTGTCACGCCCGAATTCCTCGACGCCAATCGGCTCGATTACG
TGGCCCACGACGACCTCCCGTACGGCGCCGCCGAGGGCGACGACATTTACCAGCCCATCAAGGCGACCGGCAAGT
TCCTCGTCACGCAGCGGACAGAAGGCGTCAGCACGACCGGCATCATCACAAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail