Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1214
Gene name
LocationContig_126:34500..35332
Strand+
Gene length (bp)832
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N0N3|BGBP_PENMO Beta-1,3-glucan-binding protein OS=Penaeus monodon PE=2 SV=1 91 250 4.0E-16
sp|Q76DI2|BGBP_TENMO Beta-1,3-glucan-binding protein OS=Tenebrio molitor GN=GRP PE=1 SV=1 112 250 3.0E-10
sp|Q9VVR4|BGBP2_DROME Gram-negative bacteria-binding protein 2 OS=Drosophila melanogaster GN=GNBP2 PE=2 SV=3 112 254 3.0E-09
sp|Q9NL89|BGBP_BOMMO Beta-1,3-glucan-binding protein OS=Bombyx mori PE=1 SV=1 112 250 4.0E-09
sp|Q9NJ98|BGBP1_MANSE Beta-1,3-glucan-binding protein 1 OS=Manduca sexta PE=1 SV=1 112 251 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N0N3|BGBP_PENMO Beta-1,3-glucan-binding protein OS=Penaeus monodon PE=2 SV=1 91 250 4.0E-16
sp|Q76DI2|BGBP_TENMO Beta-1,3-glucan-binding protein OS=Tenebrio molitor GN=GRP PE=1 SV=1 112 250 3.0E-10
sp|Q9VVR4|BGBP2_DROME Gram-negative bacteria-binding protein 2 OS=Drosophila melanogaster GN=GNBP2 PE=2 SV=3 112 254 3.0E-09
sp|Q9NL89|BGBP_BOMMO Beta-1,3-glucan-binding protein OS=Bombyx mori PE=1 SV=1 112 250 4.0E-09
sp|Q9NJ98|BGBP1_MANSE Beta-1,3-glucan-binding protein 1 OS=Manduca sexta PE=1 SV=1 112 251 2.0E-08
sp|Q9NHB0|BGBP1_DROME Gram-negative bacteria-binding protein 1 OS=Drosophila melanogaster GN=GNBP1 PE=2 SV=2 112 246 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 80 102 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1214
MAETQEKQEPSGDSAVQRKARLTTMPPPPSTAPSAAPPSSSSRGSLDDGFRRRFISYRLRGQYEKPWLVEKGFKK
TRLNNIIVGSLTLLGVLASAAISFLIIRPYQNLEYCLVHEDHFDRAGSLDKTVWSHVVELSDSLGTGSFDWSTAD
SRNSYIDSQGLHIVPTLTNLTTDITSAQLFANYTLDLHRDGSCTSRRNSSCVVRSDPVEGLMVPPVRSAHLTTKG
RKSIRYGRVEVVAKMPKGDWIWPAISEWP*
Coding >Hirsu2|1214
ATGGCAGAGACGCAAGAGAAGCAAGAGCCCAGCGGCGACTCGGCCGTCCAGCGCAAAGCGAGACTGACGACGATG
CCGCCACCGCCGTCCACCGCGCCGTCCGCCGCGCCGCCGTCGTCGTCATCGCGCGGCTCCCTAGACGACGGCTTC
AGACGGCGTTTTATTAGCTACCGCCTGCGAGGCCAGTATGAAAAGCCTTGGCTCGTGGAAAAGGGGTTCAAGAAA
ACACGGCTAAACAACATCATCGTCGGCTCGCTCACCCTACTTGGCGTTCTTGCCTCTGCTGCTATCAGTTTTCTC
ATCATACGCCCGTACCAAAATCTCGAGTACTGCCTCGTGCACGAGGACCACTTCGATCGGGCCGGCTCCCTTGAC
AAGACTGTCTGGTCGCACGTCGTAGAGCTATCGGATAGTCTCGGTACCGGCTCTTTCGACTGGTCGACCGCGGAC
TCGCGGAACAGCTACATAGACAGCCAAGGGCTGCACATCGTCCCCACACTCACCAATCTAACGACGGATATCACG
TCCGCCCAACTCTTTGCCAACTACACGCTCGACCTCCACCGCGACGGCTCCTGCACAAGCCGCCGCAACTCGTCG
TGCGTCGTCCGCTCCGACCCGGTCGAGGGCCTCATGGTGCCGCCGGTCCGCTCCGCCCATCTCACGACCAAGGGC
CGCAAGAGCATCCGCTACGGCAGGGTTGAGGTTGTTGCCAAGATGCCCAAGGGCGACTGGATCTGGCCGGCCATC
AGTGAGTGGCCGTAA
Transcript >Hirsu2|1214
ATGGCAGAGACGCAAGAGAAGCAAGAGCCCAGCGGCGACTCGGCCGTCCAGCGCAAAGCGAGACTGACGACGATG
CCGCCACCGCCGTCCACCGCGCCGTCCGCCGCGCCGCCGTCGTCGTCATCGCGCGGCTCCCTAGACGACGGCTTC
AGACGGCGTTTTATTAGCTACCGCCTGCGAGGCCAGTATGAAAAGCCTTGGCTCGTGGAAAAGGGGTTCAAGAAA
ACACGGCTAAACAACATCATCGTCGGCTCGCTCACCCTACTTGGCGTTCTTGCCTCTGCTGCTATCAGTTTTCTC
ATCATACGCCCGTACCAAAATCTCGAGTACTGCCTCGTGCACGAGGACCACTTCGATCGGGCCGGCTCCCTTGAC
AAGACTGTCTGGTCGCACGTCGTAGAGCTATCGGATAGTCTCGGTACCGGCTCTTTCGACTGGTCGACCGCGGAC
TCGCGGAACAGCTACATAGACAGCCAAGGGCTGCACATCGTCCCCACACTCACCAATCTAACGACGGATATCACG
TCCGCCCAACTCTTTGCCAACTACACGCTCGACCTCCACCGCGACGGCTCCTGCACAAGCCGCCGCAACTCGTCG
TGCGTCGTCCGCTCCGACCCGGTCGAGGGCCTCATGGTGCCGCCGGTCCGCTCCGCCCATCTCACGACCAAGGGC
CGCAAGAGCATCCGCTACGGCAGGGTTGAGGTTGTTGCCAAGATGCCCAAGGGCGACTGGATCTGGCCGGCCATC
AGTGAGTGGCCGTAA
Gene >Hirsu2|1214
ATGGCAGAGACGCAAGAGAAGCAAGAGCCCAGCGGCGACTCGGCCGTCCAGCGCAAAGCGAGACTGACGACGATG
CCGCCACCGCCGTCCACCGCGCCGTCCGCCGCGCCGCCGTCGTCGTCATCGCGCGGCTCCCTAGACGACGGCTTC
AGACGGCGTTTTATTAGCTACCGCCTGCGAGGCCAGTATGAAAAGCCTTGGCTCGTGGAAAAGGGGTTCAAGAAA
ACACGGCTAAACAACATCATCGTCGGCTCGCTCACCCTACTTGGCGTTCTTGCCTCTGCTGCTATCAGTTTTCTC
ATCATACGCCCGTACCAAAATCTCGAGGTAGGAGGAGTCAAGGCGTACACATCCATGGGAGGTGAAAGAAGGCAG
TGTAGCTGACGGTAAACAGTACTGCCTCGTGCACGAGGACCACTTCGATCGGGCCGGCTCCCTTGACAAGACTGT
CTGGTCGCACGTCGTAGAGCTATCGGATAGTCTCGGTACCGGCTCTTTCGACTGGTCGACCGCGGACTCGCGGAA
CAGCTACATAGACAGCCAAGGGCTGCACATCGTCCCCACACTCACCAATCTAACGACGGATATCACGTCCGCCCA
ACTCTTTGCCAACTACACGCTCGACCTCCACCGCGACGGCTCCTGCACAAGCCGCCGCAACTCGTCGTGCGTCGT
CCGCTCCGACCCGGTCGAGGGCCTCATGGTGCCGCCGGTCCGCTCCGCCCATCTCACGACCAAGGGCCGCAAGAG
CATCCGCTACGGCAGGGTTGAGGTTGTTGCCAAGATGCCCAAGGGCGACTGGATCTGGCCGGCCATCAGTGAGTG
GCCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail