Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1204
Gene name
LocationContig_126:73..1388
Strand+
Gene length (bp)1315
Transcript length (bp)1218
Coding sequence length (bp)1218
Protein length (aa) 406

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.4E-16 8 323

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q503P5|MFSD7_DANRE Major facilitator superfamily domain-containing protein 7 OS=Danio rerio GN=mfsd7 PE=2 SV=1 6 339 7.0E-34
sp|Q28FF3|MFS7A_XENTR Major facilitator superfamily domain-containing protein 7-a OS=Xenopus tropicalis GN=mfsd7-A PE=2 SV=1 6 401 7.0E-31
sp|Q9Y5Y0|FLVC1_HUMAN Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens GN=FLVCR1 PE=1 SV=1 5 357 2.0E-30
sp|Q8CE47|MFSD7_MOUSE Major facilitator superfamily domain-containing protein 7 OS=Mus musculus GN=Mfsd7 PE=2 SV=1 6 351 2.0E-28
sp|Q6P3R2|MFS7B_XENTR Major facilitator superfamily domain-containing protein 7-b OS=Xenopus tropicalis GN=mfsd7-B PE=2 SV=1 6 401 8.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q503P5|MFSD7_DANRE Major facilitator superfamily domain-containing protein 7 OS=Danio rerio GN=mfsd7 PE=2 SV=1 6 339 7.0E-34
sp|Q28FF3|MFS7A_XENTR Major facilitator superfamily domain-containing protein 7-a OS=Xenopus tropicalis GN=mfsd7-A PE=2 SV=1 6 401 7.0E-31
sp|Q9Y5Y0|FLVC1_HUMAN Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens GN=FLVCR1 PE=1 SV=1 5 357 2.0E-30
sp|Q8CE47|MFSD7_MOUSE Major facilitator superfamily domain-containing protein 7 OS=Mus musculus GN=Mfsd7 PE=2 SV=1 6 351 2.0E-28
sp|Q6P3R2|MFS7B_XENTR Major facilitator superfamily domain-containing protein 7-b OS=Xenopus tropicalis GN=mfsd7-B PE=2 SV=1 6 401 8.0E-28
sp|Q9N1F2|FLVC1_FELCA Feline leukemia virus subgroup C receptor-related protein 1 OS=Felis catus GN=FLVCR1 PE=1 SV=1 5 361 1.0E-27
sp|Q6UXD7|MFSD7_HUMAN Major facilitator superfamily domain-containing protein 7 OS=Homo sapiens GN=MFSD7 PE=2 SV=1 6 351 3.0E-26
sp|Q11073|YT45_CAEEL Uncharacterized protein B0416.5 OS=Caenorhabditis elegans GN=B0416.5 PE=4 SV=1 6 347 2.0E-25
sp|Q9UPI3|FLVC2_HUMAN Feline leukemia virus subgroup C receptor-related protein 2 OS=Homo sapiens GN=FLVCR2 PE=1 SV=1 5 402 1.0E-23
sp|Q91X85|FLVC2_MOUSE Feline leukemia virus subgroup C receptor-related protein 2 OS=Mus musculus GN=Flvcr2 PE=1 SV=2 5 351 4.0E-23
sp|Q9ES43|FLVC1_MUSTR Feline leukemia virus subgroup C receptor-related protein 1 OS=Mus terricolor GN=Flvcr1 PE=2 SV=1 5 363 3.0E-22
sp|B2RXV4|FLVC1_MOUSE Feline leukemia virus subgroup C receptor-related protein 1 OS=Mus musculus GN=Flvcr1 PE=2 SV=1 5 363 1.0E-21
sp|P60815|FLVC2_RAT Feline leukemia virus subgroup C receptor-related protein 2 OS=Rattus norvegicus GN=Flvcr2 PE=2 SV=1 5 351 1.0E-21
sp|O01735|YC91_CAEEL Uncharacterized MFS-type transporter C09D4.1 OS=Caenorhabditis elegans GN=C09D4.1 PE=3 SV=2 5 354 1.0E-20
sp|Q6GNV7|DIRC2_XENLA Disrupted in renal carcinoma protein 2 homolog OS=Xenopus laevis GN=dirc2 PE=2 SV=1 50 327 7.0E-13
sp|Q501I9|DIRC2_XENTR Disrupted in renal carcinoma protein 2 homolog OS=Xenopus tropicalis GN=dirc2 PE=2 SV=1 6 346 2.0E-09
sp|Q8BFQ6|DIRC2_MOUSE Disrupted in renal carcinoma protein 2 homolog OS=Mus musculus GN=Dirc2 PE=2 SV=1 6 330 3.0E-08
sp|Q96SL1|DIRC2_HUMAN Disrupted in renal carcinoma protein 2 OS=Homo sapiens GN=DIRC2 PE=1 SV=1 6 330 2.0E-07
sp|Q66H95|DIRC2_RAT Disrupted in renal carcinoma protein 2 homolog OS=Rattus norvegicus GN=Dirc2 PE=2 SV=1 6 330 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 57 74 17
3 81 103 22
4 118 140 22
5 153 172 19
6 202 224 22
7 237 259 22
8 264 286 22
9 295 317 22
10 332 354 22
11 366 388 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1204
MRIQQWLTYAPVAGAAAEYYGVGLATINWLSTAFFLAFVAVFPLAIAALHRGPRPALVVAAVLMLAGNWVRYAGS
TARGGGHMAPAMAGQILIGFAQPFILSAPTRYSDIWFTDGGRVAATAVASLANPLGGALAQLVCPLWVRQPGDVS
QMVLYVSVISTIACAPAFFVPAHPPTPVGPSSETPKLNLRQSARAVGGSPELWLVLVPFFVQVGLFNSVSSLLNQ
MMVPYGFSDDQAGVAGAVLIFVGLVFAAVASPVLDRTKAFLPAIRLFVPLISLCYLAFVWMPETRAVAGPYVVLA
VLGAASFASVPVALEFLTELSHPLSPEVTSTTAWAGGQLFGAVFVLVGGALAAGPDADPPANMKSSLVFHGVVAM
LVAPMPLFLGLFGRKDKVLLRRIKYNRGPG*
Coding >Hirsu2|1204
ATGCGTATACAACAGTGGCTCACGTACGCGCCCGTGGCCGGCGCGGCGGCCGAGTACTACGGCGTCGGGCTGGCG
ACGATCAACTGGCTCAGCACGGCCTTCTTCCTCGCCTTCGTGGCCGTGTTCCCGCTGGCGATCGCGGCGCTGCAC
CGCGGGCCGCGGCCGGCGCTCGTCGTGGCCGCCGTGCTGATGCTGGCGGGCAACTGGGTGCGGTACGCGGGCTCG
ACGGCGCGCGGCGGCGGCCACATGGCGCCCGCCATGGCCGGCCAGATCCTCATCGGCTTCGCCCAGCCGTTCATC
CTCTCGGCCCCGACGCGCTACTCGGACATCTGGTTCACGGACGGCGGGCGCGTCGCGGCCACGGCCGTCGCCAGC
CTGGCCAACCCGCTGGGCGGCGCGCTCGCCCAGCTCGTCTGCCCGCTGTGGGTGCGGCAGCCGGGCGATGTGTCG
CAGATGGTCCTCTACGTCTCCGTCATCTCGACCATCGCGTGCGCGCCCGCCTTCTTCGTGCCGGCGCACCCGCCG
ACGCCCGTCGGCCCCTCGTCCGAGACGCCCAAGCTCAACCTGCGGCAGTCGGCGCGGGCGGTGGGCGGCTCGCCG
GAGCTGTGGCTGGTGCTGGTGCCCTTCTTCGTCCAGGTCGGCCTGTTCAACTCGGTCTCGTCGCTGCTGAACCAG
ATGATGGTGCCGTACGGCTTCAGCGACGACCAGGCGGGCGTGGCGGGCGCGGTGCTCATCTTCGTCGGCCTCGTC
TTCGCCGCCGTCGCGTCGCCCGTGCTCGACCGCACCAAGGCCTTCTTGCCGGCCATCCGGCTCTTCGTCCCGCTC
ATCTCGCTCTGCTACCTCGCCTTCGTCTGGATGCCGGAGACGCGGGCCGTGGCCGGGCCGTACGTGGTGCTCGCC
GTCCTCGGCGCCGCCAGCTTCGCCTCCGTCCCCGTCGCGCTCGAGTTCCTCACCGAGCTGTCCCACCCGCTCAGC
CCCGAGGTGACGAGCACGACGGCCTGGGCCGGCGGCCAGCTCTTCGGCGCCGTCTTCGTCCTCGTCGGCGGCGCC
CTCGCCGCCGGGCCCGACGCCGACCCGCCCGCCAACATGAAGAGCTCGCTCGTCTTCCACGGCGTCGTCGCCATG
CTCGTCGCGCCCATGCCCCTCTTCCTCGGCCTCTTCGGCCGCAAGGACAAGGTCCTCCTGCGCCGCATCAAGTAC
AACCGCGGGCCCGGCTAG
Transcript >Hirsu2|1204
ATGCGTATACAACAGTGGCTCACGTACGCGCCCGTGGCCGGCGCGGCGGCCGAGTACTACGGCGTCGGGCTGGCG
ACGATCAACTGGCTCAGCACGGCCTTCTTCCTCGCCTTCGTGGCCGTGTTCCCGCTGGCGATCGCGGCGCTGCAC
CGCGGGCCGCGGCCGGCGCTCGTCGTGGCCGCCGTGCTGATGCTGGCGGGCAACTGGGTGCGGTACGCGGGCTCG
ACGGCGCGCGGCGGCGGCCACATGGCGCCCGCCATGGCCGGCCAGATCCTCATCGGCTTCGCCCAGCCGTTCATC
CTCTCGGCCCCGACGCGCTACTCGGACATCTGGTTCACGGACGGCGGGCGCGTCGCGGCCACGGCCGTCGCCAGC
CTGGCCAACCCGCTGGGCGGCGCGCTCGCCCAGCTCGTCTGCCCGCTGTGGGTGCGGCAGCCGGGCGATGTGTCG
CAGATGGTCCTCTACGTCTCCGTCATCTCGACCATCGCGTGCGCGCCCGCCTTCTTCGTGCCGGCGCACCCGCCG
ACGCCCGTCGGCCCCTCGTCCGAGACGCCCAAGCTCAACCTGCGGCAGTCGGCGCGGGCGGTGGGCGGCTCGCCG
GAGCTGTGGCTGGTGCTGGTGCCCTTCTTCGTCCAGGTCGGCCTGTTCAACTCGGTCTCGTCGCTGCTGAACCAG
ATGATGGTGCCGTACGGCTTCAGCGACGACCAGGCGGGCGTGGCGGGCGCGGTGCTCATCTTCGTCGGCCTCGTC
TTCGCCGCCGTCGCGTCGCCCGTGCTCGACCGCACCAAGGCCTTCTTGCCGGCCATCCGGCTCTTCGTCCCGCTC
ATCTCGCTCTGCTACCTCGCCTTCGTCTGGATGCCGGAGACGCGGGCCGTGGCCGGGCCGTACGTGGTGCTCGCC
GTCCTCGGCGCCGCCAGCTTCGCCTCCGTCCCCGTCGCGCTCGAGTTCCTCACCGAGCTGTCCCACCCGCTCAGC
CCCGAGGTGACGAGCACGACGGCCTGGGCCGGCGGCCAGCTCTTCGGCGCCGTCTTCGTCCTCGTCGGCGGCGCC
CTCGCCGCCGGGCCCGACGCCGACCCGCCCGCCAACATGAAGAGCTCGCTCGTCTTCCACGGCGTCGTCGCCATG
CTCGTCGCGCCCATGCCCCTCTTCCTCGGCCTCTTCGGCCGCAAGGACAAGGTCCTCCTGCGCCGCATCAAGTAC
AACCGCGGGCCCGGCTAG
Gene >Hirsu2|1204
ATGCGTATACAACAGTGGCTCACGTACGCGCCCGTGGCCGGCGCGGCGGCCGAGTACTACGGCGTCGGGCTGGCG
ACGATCAACTGGCTCAGCACGGCCTTCTTCCTCGCCTTCGTGGCCGTGTTCCCGCTGGCGATCGCGGCGCTGCAC
CGCGGGCCGCGGCCGGCGCTCGTCGTGGCCGCCGTGCTGATGCTGGCGGGCAACTGGGTGCGGTACGCGGGCTCG
ACGGCGCGCGGCGGCGGCCACATGGCGCCCGCCATGGCCGGCCAGATCCTCATCGGCTTCGCCCAGCCGTTCATC
CTCTCGGCCCCGACGCGCTACTCGGACATCTGGTTCACGGACGGCGGGCGCGTCGCGGCCACGGCCGTCGCCAGC
CTGGCCAACCCGCTGGGCGGCGCGCTCGCCCAGCTCGTCTGCCCGCTGTGGGTGCGGCAGCCGGGCGATGTGTCG
CAGATGGTCCTCTACGTCTCCGTCATCGTGCGTGCTCGTCGACTCCTCCTCTCTCCCACCCCCGTCGCTGGCTGG
CTAACTGTGCGGCGTCTTATTTTTTTTATTTTTTTCCCCTTTGGTTCAGTCGACCATCGCGTGCGCGCCCGCCTT
CTTCGTGCCGGCGCACCCGCCGACGCCCGTCGGCCCCTCGTCCGAGACGCCCAAGCTCAACCTGCGGCAGTCGGC
GCGGGCGGTGGGCGGCTCGCCGGAGCTGTGGCTGGTGCTGGTGCCCTTCTTCGTCCAGGTCGGCCTGTTCAACTC
GGTCTCGTCGCTGCTGAACCAGATGATGGTGCCGTACGGCTTCAGCGACGACCAGGCGGGCGTGGCGGGCGCGGT
GCTCATCTTCGTCGGCCTCGTCTTCGCCGCCGTCGCGTCGCCCGTGCTCGACCGCACCAAGGCCTTCTTGCCGGC
CATCCGGCTCTTCGTCCCGCTCATCTCGCTCTGCTACCTCGCCTTCGTCTGGATGCCGGAGACGCGGGCCGTGGC
CGGGCCGTACGTGGTGCTCGCCGTCCTCGGCGCCGCCAGCTTCGCCTCCGTCCCCGTCGCGCTCGAGTTCCTCAC
CGAGCTGTCCCACCCGCTCAGCCCCGAGGTGACGAGCACGACGGCCTGGGCCGGCGGCCAGCTCTTCGGCGCCGT
CTTCGTCCTCGTCGGCGGCGCCCTCGCCGCCGGGCCCGACGCCGACCCGCCCGCCAACATGAAGAGCTCGCTCGT
CTTCCACGGCGTCGTCGCCATGCTCGTCGCGCCCATGCCCCTCTTCCTCGGCCTCTTCGGCCGCAAGGACAAGGT
CCTCCTGCGCCGCATCAAGTACAACCGCGGGCCCGGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail